BLASTX nr result
ID: Papaver27_contig00021710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00021710 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004499110.1| PREDICTED: exocyst complex component SEC3A-l... 57 2e-06 ref|XP_002510325.1| exocyst complex component sec3, putative [Ri... 57 2e-06 ref|XP_007017431.1| Exocyst complex component sec3A isoform 1 [T... 56 5e-06 ref|XP_006473417.1| PREDICTED: exocyst complex component SEC3A-l... 56 6e-06 ref|XP_006473416.1| PREDICTED: exocyst complex component SEC3A-l... 56 6e-06 ref|XP_006434907.1| hypothetical protein CICLE_v10000230mg [Citr... 56 6e-06 ref|XP_006434906.1| hypothetical protein CICLE_v10000230mg [Citr... 56 6e-06 ref|XP_002302458.2| hypothetical protein POPTR_0002s13280g [Popu... 55 8e-06 ref|XP_006375042.1| hypothetical protein POPTR_0014s03860g [Popu... 55 8e-06 >ref|XP_004499110.1| PREDICTED: exocyst complex component SEC3A-like [Cicer arietinum] Length = 883 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKYESFAQ V KIYPNETIP+V+EM+DLLA+M Sbjct: 852 DKYESFAQLVAKIYPNETIPSVAEMRDLLASM 883 >ref|XP_002510325.1| exocyst complex component sec3, putative [Ricinus communis] gi|223551026|gb|EEF52512.1| exocyst complex component sec3, putative [Ricinus communis] Length = 889 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKYESFAQ V KIYPNETIP+V+EM+DLLA+M Sbjct: 858 DKYESFAQLVAKIYPNETIPSVAEMRDLLASM 889 >ref|XP_007017431.1| Exocyst complex component sec3A isoform 1 [Theobroma cacao] gi|508722759|gb|EOY14656.1| Exocyst complex component sec3A isoform 1 [Theobroma cacao] Length = 885 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKY+SFAQ V KIYPNETIP+V+EM+DLLA+M Sbjct: 854 DKYDSFAQLVAKIYPNETIPSVAEMRDLLASM 885 >ref|XP_006473417.1| PREDICTED: exocyst complex component SEC3A-like isoform X2 [Citrus sinensis] Length = 770 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKY+SFAQ V K+YPNETIP+V+EM+DLLA+M Sbjct: 739 DKYDSFAQLVAKVYPNETIPSVAEMRDLLASM 770 >ref|XP_006473416.1| PREDICTED: exocyst complex component SEC3A-like isoform X1 [Citrus sinensis] Length = 882 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKY+SFAQ V K+YPNETIP+V+EM+DLLA+M Sbjct: 851 DKYDSFAQLVAKVYPNETIPSVAEMRDLLASM 882 >ref|XP_006434907.1| hypothetical protein CICLE_v10000230mg [Citrus clementina] gi|557537029|gb|ESR48147.1| hypothetical protein CICLE_v10000230mg [Citrus clementina] Length = 882 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKY+SFAQ V K+YPNETIP+V+EM+DLLA+M Sbjct: 851 DKYDSFAQLVAKVYPNETIPSVAEMRDLLASM 882 >ref|XP_006434906.1| hypothetical protein CICLE_v10000230mg [Citrus clementina] gi|557537028|gb|ESR48146.1| hypothetical protein CICLE_v10000230mg [Citrus clementina] Length = 770 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKY+SFAQ V K+YPNETIP+V+EM+DLLA+M Sbjct: 739 DKYDSFAQLVAKVYPNETIPSVAEMRDLLASM 770 >ref|XP_002302458.2| hypothetical protein POPTR_0002s13280g [Populus trichocarpa] gi|550344918|gb|EEE81731.2| hypothetical protein POPTR_0002s13280g [Populus trichocarpa] Length = 886 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKYESFAQ V KIYPNE+IP+VSEM++LLA+M Sbjct: 855 DKYESFAQLVAKIYPNESIPSVSEMRELLASM 886 >ref|XP_006375042.1| hypothetical protein POPTR_0014s03860g [Populus trichocarpa] gi|550323356|gb|ERP52839.1| hypothetical protein POPTR_0014s03860g [Populus trichocarpa] Length = 886 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 378 DKYESFAQTVGKIYPNETIPAVSEMKDLLATM 283 DKYESFAQ V KIYPNE+IP+VSEM++LLA+M Sbjct: 855 DKYESFAQLVAKIYPNESIPSVSEMRELLASM 886