BLASTX nr result
ID: Papaver27_contig00020466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00020466 (496 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297990.1| PREDICTED: acylamino-acid-releasing enzyme-l... 55 1e-05 >ref|XP_004297990.1| PREDICTED: acylamino-acid-releasing enzyme-like [Fragaria vesca subsp. vesca] Length = 971 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 492 ICEVNALLDSTPLLDTNKWKPKLEPLVLPESRLVPSVEKSPIFTIKPLSESL 337 I EVNALLDS PL+D+ WK K+EPL L S +PS+ K P +K L ++L Sbjct: 147 IKEVNALLDSVPLIDSANWKSKVEPLPLSSSPPIPSIVKPPKLDLKQLPDTL 198