BLASTX nr result
ID: Papaver27_contig00020252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00020252 (803 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007014264.1| Pentatricopeptide repeat-containing protein,... 98 9e-19 ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containi... 96 2e-17 ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citr... 95 3e-17 ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 93 1e-16 emb|CBI38482.3| unnamed protein product [Vitis vinifera] 93 1e-16 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 93 1e-16 ref|XP_002866609.1| pentatricopeptide repeat-containing protein ... 91 6e-16 ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-15 gb|EPS58828.1| hypothetical protein M569_15985, partial [Genlise... 87 9e-15 ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containi... 87 9e-15 ref|XP_007141459.1| hypothetical protein PHAVU_008G197500g [Phas... 86 1e-14 ref|NP_201237.1| pentatricopeptide repeat-containing protein [Ar... 85 2e-14 ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_006352878.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [A... 86 2e-14 ref|XP_006279545.1| hypothetical protein CARUB_v10028516mg [Caps... 86 2e-14 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 84 4e-14 ref|XP_003518493.2| PREDICTED: pentatricopeptide repeat-containi... 83 1e-13 ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-13 ref|XP_003617308.1| Auxin response factor [Medicago truncatula] ... 79 2e-12 >ref|XP_007014264.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581139|ref|XP_007014265.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|590581142|ref|XP_007014266.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784627|gb|EOY31883.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784628|gb|EOY31884.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784629|gb|EOY31885.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 716 Score = 98.2 bits (243), Expect(2) = 9e-19 Identities = 45/87 (51%), Positives = 59/87 (67%) Frame = -1 Query: 302 NCSTIQIQMFSAKADKQSGTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKL 123 N ++ FS + K N + ENE E+LLKPFD++ELR + ITP+QLCK+L+L Sbjct: 15 NLQSVSKTHFSVCSSKYYSKSNQSESENEWERLLKPFDLDELRKSFNKITPYQLCKLLEL 74 Query: 122 PLSVPVSLEIFEWAGRQMGYSHSFDVY 42 PL VP SL++F WAG Q GY H+FDVY Sbjct: 75 PLDVPTSLKLFHWAGSQKGYCHTFDVY 101 Score = 22.3 bits (46), Expect(2) = 9e-19 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -3 Query: 42 YLLIGKLGAEREF 4 Y+LI KLGA +EF Sbjct: 102 YVLIDKLGAAKEF 114 >ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Citrus sinensis] gi|568867543|ref|XP_006487096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Citrus sinensis] Length = 728 Score = 95.5 bits (236), Expect = 2e-17 Identities = 48/88 (54%), Positives = 61/88 (69%) Frame = -1 Query: 305 TNCSTIQIQMFSAKADKQSGTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILK 126 +N TI +A++ QS N + ENE E+LLKPFD+ ELR +L+ ITP QLCK+L+ Sbjct: 33 SNSCTIDYSNCTARSICQS---NDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLR 89 Query: 125 LPLSVPVSLEIFEWAGRQMGYSHSFDVY 42 LPL V S+EIF WAG Q GY H+FDVY Sbjct: 90 LPLDVDTSMEIFTWAGSQEGYCHTFDVY 117 >ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] gi|557524968|gb|ESR36274.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] Length = 728 Score = 95.1 bits (235), Expect = 3e-17 Identities = 47/88 (53%), Positives = 62/88 (70%) Frame = -1 Query: 305 TNCSTIQIQMFSAKADKQSGTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILK 126 +N TI + +A++ QS N + ENE E+LLKPFD+ ELR +L+ ITP QLCK+L+ Sbjct: 33 SNSCTIDYRNCTARSICQS---NDSESENEWERLLKPFDLNELRKSLHKITPFQLCKLLR 89 Query: 125 LPLSVPVSLEIFEWAGRQMGYSHSFDVY 42 LPL V S+E+F WAG Q GY H+FDVY Sbjct: 90 LPLDVDTSMELFTWAGSQEGYCHTFDVY 117 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 92.8 bits (229), Expect = 1e-16 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 239 NSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYS 60 N +D E E+LLKPFD+ ELR +L ITP+QLCK+L+LPL VP S+E+F+WAG Q GY Sbjct: 67 NGLDSGTEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQKGYC 126 Query: 59 HSFDVY 42 H FDVY Sbjct: 127 HMFDVY 132 >emb|CBI38482.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 92.8 bits (229), Expect = 1e-16 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 239 NSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYS 60 N +D E E+LLKPFD+ ELR +L ITP+QLCK+L+LPL VP S+E+F+WAG Q GY Sbjct: 49 NGLDSGTEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQKGYC 108 Query: 59 HSFDVY 42 H FDVY Sbjct: 109 HMFDVY 114 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 92.8 bits (229), Expect = 1e-16 Identities = 41/66 (62%), Positives = 51/66 (77%) Frame = -1 Query: 239 NSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYS 60 N +D E E+LLKPFD+ ELR +L ITP+QLCK+L+LPL VP S+E+F+WAG Q GY Sbjct: 49 NGLDSGTEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSMELFQWAGTQKGYC 108 Query: 59 HSFDVY 42 H FDVY Sbjct: 109 HMFDVY 114 >ref|XP_002866609.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312444|gb|EFH42868.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 724 Score = 90.5 bits (223), Expect = 6e-16 Identities = 40/65 (61%), Positives = 49/65 (75%) Frame = -1 Query: 236 SVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSH 57 S D NE EKLLKPFD++ LR++ + ITP QLCK+L+LPL V S+E+F W G Q GY H Sbjct: 44 SPDSSNEWEKLLKPFDLDSLRNSFHKITPFQLCKLLELPLDVSTSMELFSWTGSQKGYRH 103 Query: 56 SFDVY 42 SFDVY Sbjct: 104 SFDVY 108 >ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 711 Score = 89.0 bits (219), Expect = 2e-15 Identities = 43/69 (62%), Positives = 52/69 (75%) Frame = -1 Query: 248 GTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQM 69 G+ +S +ENE E+LLKPFD+ ELR +L ITP QL K+L+LPL VP SLE+FE G Q Sbjct: 31 GSDDSGSEENEWERLLKPFDLNELRKSLIQITPIQLSKLLELPLDVPTSLEVFEMVGAQR 90 Query: 68 GYSHSFDVY 42 GY HSFDVY Sbjct: 91 GYRHSFDVY 99 >gb|EPS58828.1| hypothetical protein M569_15985, partial [Genlisea aurea] Length = 542 Score = 86.7 bits (213), Expect = 9e-15 Identities = 42/60 (70%), Positives = 47/60 (78%) Frame = -1 Query: 221 NECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSHSFDVY 42 NE EKLLKPFD EELR TL ITP QL +L+LPL VP S+E+F +AG QMGY HSFDVY Sbjct: 1 NEWEKLLKPFDFEELRKTLNKITPSQLNMLLQLPLDVPTSMELFHFAGAQMGYCHSFDVY 60 >ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Solanum lycopersicum] Length = 720 Score = 86.7 bits (213), Expect = 9e-15 Identities = 40/75 (53%), Positives = 52/75 (69%) Frame = -1 Query: 266 KADKQSGTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFE 87 K D + + ENE E+LLKPFD ++L+ +L ITP+QL K+L LPL VP S+E+F+ Sbjct: 34 KCDNAKARGDGSESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQ 93 Query: 86 WAGRQMGYSHSFDVY 42 WAG Q Y HSFDVY Sbjct: 94 WAGSQTSYCHSFDVY 108 >ref|XP_007141459.1| hypothetical protein PHAVU_008G197500g [Phaseolus vulgaris] gi|561014592|gb|ESW13453.1| hypothetical protein PHAVU_008G197500g [Phaseolus vulgaris] Length = 721 Score = 85.9 bits (211), Expect(2) = 1e-14 Identities = 38/67 (56%), Positives = 50/67 (74%) Frame = -1 Query: 242 CNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGY 63 C S D E E E+LLKPFD+++LR +L I+P QLCK+L LPL +P S+E+F+ AG Q GY Sbjct: 40 CESSDSETEWERLLKPFDLKQLRRSLTPISPFQLCKLLVLPLDIPTSMELFQRAGAQKGY 99 Query: 62 SHSFDVY 42 H+FD Y Sbjct: 100 CHTFDAY 106 Score = 20.8 bits (42), Expect(2) = 1e-14 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 54 F*CIYLLIGKLGAEREF 4 F YLLI KLGA +F Sbjct: 103 FDAYYLLIDKLGAVGDF 119 >ref|NP_201237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171655|sp|Q9FMF6.1|PP444_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g64320, mitochondrial; Flags: Precursor gi|9759408|dbj|BAB09863.1| unnamed protein product [Arabidopsis thaliana] gi|332010486|gb|AED97869.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 730 Score = 85.1 bits (209), Expect(2) = 2e-14 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = -1 Query: 230 DDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSHSF 51 D NE EKLLKPFD++ LR++ + ITP QL K+L+LPL+V S+E+F W G Q GY HSF Sbjct: 52 DSANEWEKLLKPFDLDSLRNSFHKITPFQLYKLLELPLNVSTSMELFSWTGSQNGYRHSF 111 Query: 50 DVY 42 DVY Sbjct: 112 DVY 114 Score = 21.2 bits (43), Expect(2) = 2e-14 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -3 Query: 39 LLIGKLGAEREF 4 +LIGKLGA EF Sbjct: 116 VLIGKLGANGEF 127 >ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565372595|ref|XP_006352877.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 720 Score = 84.3 bits (207), Expect(2) = 2e-14 Identities = 39/75 (52%), Positives = 51/75 (68%) Frame = -1 Query: 266 KADKQSGTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFE 87 K D + + ENE E+LLKPFD ++L+ +L ITP+QL K+L LPL VP S+E+F+ Sbjct: 34 KGDNAKARGDGSESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQ 93 Query: 86 WAGRQMGYSHSFDVY 42 WA Q Y HSFDVY Sbjct: 94 WASSQTSYCHSFDVY 108 Score = 21.6 bits (44), Expect(2) = 2e-14 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 42 YLLIGKLGAEREF 4 Y LI KLGA +EF Sbjct: 109 YTLIDKLGAAKEF 121 >ref|XP_006352878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 612 Score = 84.3 bits (207), Expect(2) = 2e-14 Identities = 39/75 (52%), Positives = 51/75 (68%) Frame = -1 Query: 266 KADKQSGTCNSVDDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFE 87 K D + + ENE E+LLKPFD ++L+ +L ITP+QL K+L LPL VP S+E+F+ Sbjct: 34 KGDNAKARGDGSESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQ 93 Query: 86 WAGRQMGYSHSFDVY 42 WA Q Y HSFDVY Sbjct: 94 WASSQTSYCHSFDVY 108 Score = 21.6 bits (44), Expect(2) = 2e-14 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -3 Query: 42 YLLIGKLGAEREF 4 Y LI KLGA +EF Sbjct: 109 YTLIDKLGAAKEF 121 >ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] gi|548839447|gb|ERM99736.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] Length = 712 Score = 85.5 bits (210), Expect = 2e-14 Identities = 39/61 (63%), Positives = 48/61 (78%) Frame = -1 Query: 224 ENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSHSFDV 45 ENE EK+LKPF +EELR + ITP +LCK+L LPL + +SLEIFEWA Q GYSH++DV Sbjct: 44 ENEWEKILKPFGLEELRKSFNRITPQRLCKLLFLPLDLSLSLEIFEWAASQKGYSHTYDV 103 Query: 44 Y 42 Y Sbjct: 104 Y 104 >ref|XP_006279545.1| hypothetical protein CARUB_v10028516mg [Capsella rubella] gi|482548249|gb|EOA12443.1| hypothetical protein CARUB_v10028516mg [Capsella rubella] Length = 728 Score = 85.5 bits (210), Expect = 2e-14 Identities = 43/82 (52%), Positives = 52/82 (63%), Gaps = 12/82 (14%) Frame = -1 Query: 251 SGTCNSVDD------------ENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVP 108 SG C DD NE EKLLKPFDI+ LR++++ ITP QL K+L+LPL V Sbjct: 31 SGFCGGGDDVGGSTENGAAASANEWEKLLKPFDIDSLRNSIHKITPFQLYKLLELPLDVS 90 Query: 107 VSLEIFEWAGRQMGYSHSFDVY 42 S+E+F W G Q GY HSFDVY Sbjct: 91 TSMELFSWTGSQKGYRHSFDVY 112 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 84.3 bits (207), Expect(2) = 4e-14 Identities = 38/63 (60%), Positives = 48/63 (76%) Frame = -1 Query: 230 DDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSHSF 51 ++E E E+LLKPFD++ELR + ITP QLCK+L LPL V S+ IF+WAG Q GY H+F Sbjct: 43 ENETEWERLLKPFDLKELRRSFNQITPFQLCKLLLLPLDVSTSMAIFQWAGSQKGYCHTF 102 Query: 50 DVY 42 DVY Sbjct: 103 DVY 105 Score = 20.4 bits (41), Expect(2) = 4e-14 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 42 YLLIGKLGAEREF 4 ++LI KLGA +EF Sbjct: 106 HVLIDKLGAAKEF 118 >ref|XP_003518493.2| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Glycine max] Length = 739 Score = 82.8 bits (203), Expect(2) = 1e-13 Identities = 39/75 (52%), Positives = 57/75 (76%), Gaps = 2/75 (2%) Frame = -1 Query: 266 KADKQSGTCNSVDDENECEKLLKPFDIEELRDTLY--GITPHQLCKILKLPLSVPVSLEI 93 +A+ S + +S D+E E E+LLKPFD+++LR +L I+P QLCK+L+LPL +P S+E+ Sbjct: 40 EAESSSSSSSSSDNETEWERLLKPFDLKQLRRSLSLTPISPFQLCKLLELPLDIPTSMEL 99 Query: 92 FEWAGRQMGYSHSFD 48 F+ AG Q GYSH+FD Sbjct: 100 FQRAGAQKGYSHTFD 114 Score = 20.8 bits (42), Expect(2) = 1e-13 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 54 F*CIYLLIGKLGAEREF 4 F YLLI KLGA +F Sbjct: 113 FDACYLLIDKLGAVGDF 129 >ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Cicer arietinum] gi|502151414|ref|XP_004508429.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Cicer arietinum] gi|502151416|ref|XP_004508430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Cicer arietinum] gi|502151418|ref|XP_004508431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X4 [Cicer arietinum] Length = 712 Score = 79.3 bits (194), Expect(2) = 6e-13 Identities = 35/63 (55%), Positives = 48/63 (76%) Frame = -1 Query: 230 DDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSHSF 51 + + E E++LKPFD++ L+ +L ITP QLCK+L+LPL +P S+E+FE AG Q GY HSF Sbjct: 43 ESDTEWERVLKPFDLKHLQRSLNPITPSQLCKLLELPLDIPTSMELFEKAGSQRGYCHSF 102 Query: 50 DVY 42 VY Sbjct: 103 HVY 105 Score = 21.6 bits (44), Expect(2) = 6e-13 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = -3 Query: 42 YLLIGKLGAEREF 4 YLLI KLGA EF Sbjct: 106 YLLIDKLGAVGEF 118 >ref|XP_003617308.1| Auxin response factor [Medicago truncatula] gi|355518643|gb|AET00267.1| Auxin response factor [Medicago truncatula] Length = 948 Score = 79.0 bits (193), Expect = 2e-12 Identities = 36/63 (57%), Positives = 48/63 (76%) Frame = -1 Query: 230 DDENECEKLLKPFDIEELRDTLYGITPHQLCKILKLPLSVPVSLEIFEWAGRQMGYSHSF 51 +D+ E E LLKP+D++ L+ +L ITP QLCK+L+LPL VP S+++FE AG Q GY HSF Sbjct: 35 NDDTEWENLLKPYDLKHLQRSLNPITPSQLCKLLELPLDVPTSMDLFEKAGLQRGYIHSF 94 Query: 50 DVY 42 VY Sbjct: 95 HVY 97