BLASTX nr result
ID: Papaver27_contig00020219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00020219 (579 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843220.1| hypothetical protein AMTR_s00080p00039920 [A... 77 4e-12 emb|CBI32614.3| unnamed protein product [Vitis vinifera] 77 4e-12 ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_004497462.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_004497461.1| PREDICTED: pentatricopeptide repeat-containi... 75 1e-11 ref|XP_006361774.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_004306228.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_007206428.1| hypothetical protein PRUPE_ppa001926mg [Prun... 73 6e-11 ref|XP_002456190.1| hypothetical protein SORBIDRAFT_03g031900 [S... 72 8e-11 gb|EXC16278.1| hypothetical protein L484_024452 [Morus notabilis] 72 1e-10 ref|XP_006428878.1| hypothetical protein CICLE_v10011148mg [Citr... 72 1e-10 ref|XP_002322855.2| hypothetical protein POPTR_0016s08650g [Popu... 72 1e-10 ref|XP_004969633.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 gb|EYU41632.1| hypothetical protein MIMGU_mgv1a001890mg [Mimulus... 72 1e-10 tpg|DAA58005.1| TPA: hypothetical protein ZEAMMB73_979671 [Zea m... 71 2e-10 gb|EMT09297.1| hypothetical protein F775_18031 [Aegilops tauschii] 70 3e-10 gb|EMS61014.1| hypothetical protein TRIUR3_17702 [Triticum urartu] 70 3e-10 ref|XP_003577175.1| PREDICTED: pentatricopeptide repeat-containi... 70 4e-10 dbj|BAJ98927.1| predicted protein [Hordeum vulgare subsp. vulgare] 70 4e-10 ref|XP_007144529.1| hypothetical protein PHAVU_007G163500g [Phas... 70 5e-10 >ref|XP_006843220.1| hypothetical protein AMTR_s00080p00039920 [Amborella trichopoda] gi|548845504|gb|ERN04895.1| hypothetical protein AMTR_s00080p00039920 [Amborella trichopoda] Length = 718 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 SKAR+DRRSDRK+AAEAFKFWLGLPNSYYGSEWRLE Sbjct: 672 SKARRDRRSDRKRAAEAFKFWLGLPNSYYGSEWRLE 707 >emb|CBI32614.3| unnamed protein product [Vitis vinifera] Length = 723 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 SKARQDRRS+RK+AAEAFKFWLGLPNSYYGSEWRLE Sbjct: 665 SKARQDRRSERKRAAEAFKFWLGLPNSYYGSEWRLE 700 >ref|XP_002273172.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Vitis vinifera] Length = 749 Score = 76.6 bits (187), Expect = 4e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 SKARQDRRS+RK+AAEAFKFWLGLPNSYYGSEWRLE Sbjct: 702 SKARQDRRSERKRAAEAFKFWLGLPNSYYGSEWRLE 737 >ref|XP_004497462.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like isoform X2 [Cicer arietinum] Length = 732 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLEADSFYAT 449 SKARQDRR +RK+AAEAFKFWLGLPNSYYGSEWRLE Y T Sbjct: 687 SKARQDRRVERKRAAEAFKFWLGLPNSYYGSEWRLEPLDGYDT 729 >ref|XP_004497461.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like isoform X1 [Cicer arietinum] Length = 732 Score = 75.1 bits (183), Expect = 1e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLEADSFYAT 449 SKARQDRR +RK+AAEAFKFWLGLPNSYYGSEWRLE Y T Sbjct: 687 SKARQDRRVERKRAAEAFKFWLGLPNSYYGSEWRLEPLDGYDT 729 >ref|XP_006361774.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Solanum tuberosum] Length = 738 Score = 73.2 bits (178), Expect = 5e-11 Identities = 31/37 (83%), Positives = 36/37 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLEA 467 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWRL++ Sbjct: 693 SRARQDRRKERKRAAEAFKFWLGLPNSYYGSEWRLDS 729 >ref|XP_004306228.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 743 Score = 73.2 bits (178), Expect = 5e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRL 473 S+ARQDRRS+RK+AAEAFKFWLGLPNSYYGSEWRL Sbjct: 702 SQARQDRRSERKRAAEAFKFWLGLPNSYYGSEWRL 736 >ref|XP_007206428.1| hypothetical protein PRUPE_ppa001926mg [Prunus persica] gi|462402070|gb|EMJ07627.1| hypothetical protein PRUPE_ppa001926mg [Prunus persica] Length = 740 Score = 72.8 bits (177), Expect = 6e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWRLE Sbjct: 699 SQARQDRRIERKRAAEAFKFWLGLPNSYYGSEWRLE 734 >ref|XP_002456190.1| hypothetical protein SORBIDRAFT_03g031900 [Sorghum bicolor] gi|241928165|gb|EES01310.1| hypothetical protein SORBIDRAFT_03g031900 [Sorghum bicolor] Length = 731 Score = 72.4 bits (176), Expect = 8e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWR+E Sbjct: 687 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRIE 722 >gb|EXC16278.1| hypothetical protein L484_024452 [Morus notabilis] Length = 749 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR ++K+AAEAFKFWLGLPNSYYGSEWRLE Sbjct: 702 SQARQDRRREKKRAAEAFKFWLGLPNSYYGSEWRLE 737 >ref|XP_006428878.1| hypothetical protein CICLE_v10011148mg [Citrus clementina] gi|568853953|ref|XP_006480600.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Citrus sinensis] gi|557530935|gb|ESR42118.1| hypothetical protein CICLE_v10011148mg [Citrus clementina] Length = 740 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWRL+ Sbjct: 692 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRLD 727 >ref|XP_002322855.2| hypothetical protein POPTR_0016s08650g [Populus trichocarpa] gi|550321129|gb|EEF04616.2| hypothetical protein POPTR_0016s08650g [Populus trichocarpa] Length = 724 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWRL+ Sbjct: 683 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRLD 718 >ref|XP_004969633.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Setaria italica] Length = 734 Score = 72.0 bits (175), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWR+E Sbjct: 689 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRVE 724 >gb|EYU41632.1| hypothetical protein MIMGU_mgv1a001890mg [Mimulus guttatus] Length = 744 Score = 71.6 bits (174), Expect = 1e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 SKARQDRR +RK+AAEAFKFWLGLPN+YYGSEWR++ Sbjct: 704 SKARQDRRRERKRAAEAFKFWLGLPNTYYGSEWRID 739 >tpg|DAA58005.1| TPA: hypothetical protein ZEAMMB73_979671 [Zea mays] Length = 730 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRLE 470 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEW++E Sbjct: 686 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWQIE 721 >gb|EMT09297.1| hypothetical protein F775_18031 [Aegilops tauschii] Length = 256 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRL 473 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWR+ Sbjct: 206 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRI 240 >gb|EMS61014.1| hypothetical protein TRIUR3_17702 [Triticum urartu] Length = 465 Score = 70.5 bits (171), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRL 473 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWR+ Sbjct: 414 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRI 448 >ref|XP_003577175.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09650, chloroplastic-like [Brachypodium distachyon] Length = 725 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRL 473 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWR+ Sbjct: 676 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRV 710 >dbj|BAJ98927.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 733 Score = 70.1 bits (170), Expect = 4e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYYGSEWRL 473 S+ARQDRR +RK+AAEAFKFWLGLPNSYYGSEWR+ Sbjct: 684 SQARQDRRRERKRAAEAFKFWLGLPNSYYGSEWRV 718 >ref|XP_007144529.1| hypothetical protein PHAVU_007G163500g [Phaseolus vulgaris] gi|561017719|gb|ESW16523.1| hypothetical protein PHAVU_007G163500g [Phaseolus vulgaris] Length = 713 Score = 69.7 bits (169), Expect = 5e-10 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 1/37 (2%) Frame = -3 Query: 577 SKARQDRRSDRKKAAEAFKFWLGLPNSYY-GSEWRLE 470 S+ARQDRR++RK+AAEAFKFWLGLPNSYY GSEWRLE Sbjct: 665 SRARQDRRTERKRAAEAFKFWLGLPNSYYDGSEWRLE 701