BLASTX nr result
ID: Papaver27_contig00019849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00019849 (444 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041524.1| Uncharacterized protein isoform 3 [Theobroma... 60 3e-07 ref|XP_007041522.1| Uncharacterized protein isoform 1 [Theobroma... 60 3e-07 >ref|XP_007041524.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508705459|gb|EOX97355.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 827 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +2 Query: 2 VKRFRSFIKERWDTIPAAPVVVLPYENGAETLSPNPTKETDKKGSQK 142 V+RF SF+KERWDT+PAAPV+VLP+E G E+ S N ++DKK +K Sbjct: 775 VRRFISFLKERWDTVPAAPVIVLPFE-GEESRSVNQRSQSDKKAIRK 820 >ref|XP_007041522.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590683145|ref|XP_007041523.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508705457|gb|EOX97353.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508705458|gb|EOX97354.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 826 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +2 Query: 2 VKRFRSFIKERWDTIPAAPVVVLPYENGAETLSPNPTKETDKKGSQK 142 V+RF SF+KERWDT+PAAPV+VLP+E G E+ S N ++DKK +K Sbjct: 774 VRRFISFLKERWDTVPAAPVIVLPFE-GEESRSVNQRSQSDKKAIRK 819