BLASTX nr result
ID: Papaver27_contig00019830
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00019830 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363025.1| PREDICTED: protein DGCR14-like [Solanum tube... 74 3e-11 ref|XP_004243545.1| PREDICTED: protein DGCR14-like [Solanum lyco... 74 3e-11 ref|XP_007049279.1| DGCR14-related [Theobroma cacao] gi|50870154... 73 5e-11 ref|XP_006838454.1| hypothetical protein AMTR_s00002p00135750 [A... 72 8e-11 gb|ADK92867.1| DGCR-like protein [Hypericum perforatum] 72 1e-10 ref|XP_002301584.1| DGCR14-related family protein [Populus trich... 72 1e-10 emb|CBI28411.3| unnamed protein product [Vitis vinifera] 70 3e-10 ref|XP_002272703.1| PREDICTED: protein DGCR14 [Vitis vinifera] 70 3e-10 ref|XP_004164059.1| PREDICTED: protein DGCR14 homolog, partial [... 70 4e-10 ref|XP_004144540.1| PREDICTED: protein DGCR14 homolog [Cucumis s... 70 4e-10 ref|XP_002966563.1| hypothetical protein SELMODRAFT_85338 [Selag... 70 4e-10 ref|XP_002463174.1| hypothetical protein SORBIDRAFT_02g039100 [S... 69 5e-10 gb|EPS68545.1| hypothetical protein M569_06220, partial [Genlise... 69 7e-10 ref|XP_007215265.1| hypothetical protein PRUPE_ppa004562mg [Prun... 69 7e-10 gb|AFW66768.1| hypothetical protein ZEAMMB73_671811 [Zea mays] 69 7e-10 gb|AFW66766.1| hypothetical protein ZEAMMB73_320257 [Zea mays] 69 7e-10 gb|AFW66765.1| hypothetical protein ZEAMMB73_266527 [Zea mays] 69 7e-10 ref|XP_002982400.1| hypothetical protein SELMODRAFT_116099 [Sela... 69 7e-10 ref|NP_001150845.1| DGCR14 protein [Zea mays] gi|195642346|gb|AC... 69 7e-10 gb|EYU42747.1| hypothetical protein MIMGU_mgv1a004762mg [Mimulus... 69 9e-10 >ref|XP_006363025.1| PREDICTED: protein DGCR14-like [Solanum tuberosum] Length = 510 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 234 SKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 +K+ + VLDEDTYVA+IEKIIERDFFPDIPKLRDRLDWL Sbjct: 41 NKRRSKVLDEDTYVAAIEKIIERDFFPDIPKLRDRLDWL 79 >ref|XP_004243545.1| PREDICTED: protein DGCR14-like [Solanum lycopersicum] Length = 510 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 234 SKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 +K+ + VLDEDTYVA+IEKIIERDFFPDIPKLRDRLDWL Sbjct: 41 NKRRSKVLDEDTYVAAIEKIIERDFFPDIPKLRDRLDWL 79 >ref|XP_007049279.1| DGCR14-related [Theobroma cacao] gi|508701540|gb|EOX93436.1| DGCR14-related [Theobroma cacao] Length = 652 Score = 72.8 bits (177), Expect = 5e-11 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 231 PSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 PS+K VLDEDTYVA+IEKIIERDFFPDI KLRDRLDWL Sbjct: 39 PSRKRARVLDEDTYVAAIEKIIERDFFPDISKLRDRLDWL 78 >ref|XP_006838454.1| hypothetical protein AMTR_s00002p00135750 [Amborella trichopoda] gi|548840960|gb|ERN01023.1| hypothetical protein AMTR_s00002p00135750 [Amborella trichopoda] Length = 460 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 228 KPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 KP H VLDED+YVA+IEKI+ERDFFPDIPKL+DRLDWL Sbjct: 28 KPKCAHPKVLDEDSYVAAIEKIVERDFFPDIPKLQDRLDWL 68 >gb|ADK92867.1| DGCR-like protein [Hypericum perforatum] Length = 521 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 231 PSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 PS+K +VLDEDTYVA+IEKIIERD+FPDI KL+DRLDWL Sbjct: 41 PSRKRQAVLDEDTYVAAIEKIIERDYFPDIAKLQDRLDWL 80 >ref|XP_002301584.1| DGCR14-related family protein [Populus trichocarpa] gi|222843310|gb|EEE80857.1| DGCR14-related family protein [Populus trichocarpa] Length = 514 Score = 71.6 bits (174), Expect = 1e-10 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 240 KHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 KH +VLDEDTYVA+IEKIIERDFFPDI KLRDRLDWL Sbjct: 43 KHPTVLDEDTYVATIEKIIERDFFPDISKLRDRLDWL 79 >emb|CBI28411.3| unnamed protein product [Vitis vinifera] Length = 831 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 237 KKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 +K +VLDEDTYVA+IEKI+ERDFFPDIPKLRDRL+WL Sbjct: 57 RKEVTVLDEDTYVAAIEKIVERDFFPDIPKLRDRLEWL 94 >ref|XP_002272703.1| PREDICTED: protein DGCR14 [Vitis vinifera] Length = 504 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 237 KKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 +K +VLDEDTYVA+IEKI+ERDFFPDIPKLRDRL+WL Sbjct: 40 RKEVTVLDEDTYVAAIEKIVERDFFPDIPKLRDRLEWL 77 >ref|XP_004164059.1| PREDICTED: protein DGCR14 homolog, partial [Cucumis sativus] Length = 410 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +3 Query: 216 VESSKPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 + + + S+KH VLDED+YV +IEKIIERD+FPDI KLRDRLDWL Sbjct: 34 ITTPQSSRKHPKVLDEDSYVEAIEKIIERDYFPDISKLRDRLDWL 78 >ref|XP_004144540.1| PREDICTED: protein DGCR14 homolog [Cucumis sativus] Length = 509 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +3 Query: 216 VESSKPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 + + + S+KH VLDED+YV +IEKIIERD+FPDI KLRDRLDWL Sbjct: 34 ITTPQSSRKHPKVLDEDSYVEAIEKIIERDYFPDISKLRDRLDWL 78 >ref|XP_002966563.1| hypothetical protein SELMODRAFT_85338 [Selaginella moellendorffii] gi|300165983|gb|EFJ32590.1| hypothetical protein SELMODRAFT_85338 [Selaginella moellendorffii] Length = 508 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/41 (70%), Positives = 39/41 (95%) Frame = +3 Query: 228 KPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 KP K+ ++VLDEDTYVA+IE+I+ERDFFPDIPKL+++L+WL Sbjct: 44 KPRKRSHAVLDEDTYVAAIERIVERDFFPDIPKLQNKLEWL 84 >ref|XP_002463174.1| hypothetical protein SORBIDRAFT_02g039100 [Sorghum bicolor] gi|241926551|gb|EER99695.1| hypothetical protein SORBIDRAFT_02g039100 [Sorghum bicolor] Length = 491 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +3 Query: 222 SSKPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 S+ ++ VLDEDTYVA+IE+IIERDFFPD+P+LRDRLDWL Sbjct: 38 SASSKRRRPEVLDEDTYVAAIERIIERDFFPDLPRLRDRLDWL 80 >gb|EPS68545.1| hypothetical protein M569_06220, partial [Genlisea aurea] Length = 491 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 237 KKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 ++ + VLDED YVASIEKIIERDFFPDIPKLRDRLDW+ Sbjct: 45 RRKSIVLDEDIYVASIEKIIERDFFPDIPKLRDRLDWI 82 >ref|XP_007215265.1| hypothetical protein PRUPE_ppa004562mg [Prunus persica] gi|462411415|gb|EMJ16464.1| hypothetical protein PRUPE_ppa004562mg [Prunus persica] Length = 503 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/43 (74%), Positives = 37/43 (86%) Frame = +3 Query: 222 SSKPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 +S+ + H +VLDEDTYV +IEKIIERDFFPDI KLRDRLDWL Sbjct: 35 TSRNPRGHPTVLDEDTYVDAIEKIIERDFFPDISKLRDRLDWL 77 >gb|AFW66768.1| hypothetical protein ZEAMMB73_671811 [Zea mays] Length = 539 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +3 Query: 222 SSKPSKKH--NSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 S+ PS K + VLDEDTYVA+IE+IIERD+FPD+P+LRDRLDWL Sbjct: 77 SNAPSSKRRRSEVLDEDTYVAAIERIIERDYFPDLPRLRDRLDWL 121 >gb|AFW66766.1| hypothetical protein ZEAMMB73_320257 [Zea mays] Length = 456 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +3 Query: 222 SSKPSKKH--NSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 S+ PS K + VLDEDTYVA+IE+IIERD+FPD+P+LRDRLDWL Sbjct: 31 SNAPSSKRRRSEVLDEDTYVAAIERIIERDYFPDLPRLRDRLDWL 75 >gb|AFW66765.1| hypothetical protein ZEAMMB73_266527 [Zea mays] Length = 493 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +3 Query: 222 SSKPSKKH--NSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 S+ PS K + VLDEDTYVA+IE+IIERD+FPD+P+LRDRLDWL Sbjct: 31 STAPSSKRRRSEVLDEDTYVAAIERIIERDYFPDLPRLRDRLDWL 75 >ref|XP_002982400.1| hypothetical protein SELMODRAFT_116099 [Selaginella moellendorffii] gi|300149992|gb|EFJ16645.1| hypothetical protein SELMODRAFT_116099 [Selaginella moellendorffii] Length = 508 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/41 (70%), Positives = 38/41 (92%) Frame = +3 Query: 228 KPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 KP K ++VLDEDTYVA+IE+I+ERDFFPDIPKL+++L+WL Sbjct: 44 KPRKSSHAVLDEDTYVAAIERIVERDFFPDIPKLQNKLEWL 84 >ref|NP_001150845.1| DGCR14 protein [Zea mays] gi|195642346|gb|ACG40641.1| DGCR14 protein [Zea mays] Length = 492 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = +3 Query: 222 SSKPSKKH--NSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 S+ PS K + VLDEDTYVA+IE+IIERD+FPD+P+LRDRLDWL Sbjct: 31 STAPSSKRRRSEVLDEDTYVAAIERIIERDYFPDLPRLRDRLDWL 75 >gb|EYU42747.1| hypothetical protein MIMGU_mgv1a004762mg [Mimulus guttatus] Length = 511 Score = 68.6 bits (166), Expect = 9e-10 Identities = 30/42 (71%), Positives = 38/42 (90%) Frame = +3 Query: 225 SKPSKKHNSVLDEDTYVASIEKIIERDFFPDIPKLRDRLDWL 350 ++ ++ +VLDED+YVA+IEKIIERD+FPDIPKLRDRLDWL Sbjct: 33 TRKRRRSPTVLDEDSYVAAIEKIIERDYFPDIPKLRDRLDWL 74