BLASTX nr result
ID: Papaver27_contig00019812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00019812 (886 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029495.1| Pentatricopeptide repeat-containing protein,... 72 3e-10 ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-10 ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containi... 71 5e-10 ref|XP_006850860.1| hypothetical protein AMTR_s00025p00142780 [A... 71 5e-10 ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 emb|CBI26569.3| unnamed protein product [Vitis vinifera] 70 8e-10 ref|XP_006657333.1| PREDICTED: pentatricopeptide repeat-containi... 70 1e-09 ref|XP_004164250.1| PREDICTED: putative pentatricopeptide repeat... 69 2e-09 ref|XP_004146932.1| PREDICTED: putative pentatricopeptide repeat... 69 2e-09 ref|NP_001174991.1| Os06g0710800 [Oryza sativa Japonica Group] g... 68 4e-09 ref|XP_006491815.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_006428506.1| hypothetical protein CICLE_v10011504mg [Citr... 67 7e-09 ref|XP_006590461.1| PREDICTED: pentatricopeptide repeat-containi... 67 1e-08 ref|XP_002519998.1| pentatricopeptide repeat-containing protein,... 66 2e-08 ref|XP_002437576.1| hypothetical protein SORBIDRAFT_10g029640 [S... 65 4e-08 gb|EXB29192.1| hypothetical protein L484_019727 [Morus notabilis] 64 6e-08 gb|EYU45363.1| hypothetical protein MIMGU_mgv1a022626mg [Mimulus... 63 1e-07 ref|XP_006573837.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 gb|AFW69441.1| hypothetical protein ZEAMMB73_914225 [Zea mays] 63 1e-07 ref|XP_003563545.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 >ref|XP_007029495.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508718100|gb|EOY09997.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 513 Score = 72.0 bits (175), Expect = 3e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAFIRAKKFD+V IY EM+S+GCTPDRKAR++LQTA VLE+R Sbjct: 467 LMKAFIRAKKFDRVPEIYREMESSGCTPDRKARQMLQTALMVLEQR 512 >ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 523 Score = 71.6 bits (174), Expect = 4e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAF+RAKKFDQV IY EM+S GCTPDRKARE+LQ+A +LE+R Sbjct: 476 LMKAFLRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565369409|ref|XP_006351328.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565369411|ref|XP_006351329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 523 Score = 71.2 bits (173), Expect = 5e-10 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAF+RAKKFDQV IY EM+S GCTPDRKARE+LQ+A +LE+R Sbjct: 476 LMKAFMRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQR 521 >ref|XP_006850860.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] gi|548854531|gb|ERN12441.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] Length = 416 Score = 71.2 bits (173), Expect = 5e-10 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKRQG 743 LMKAF RA+KFDQV +Y+EM+SAGC PDRKARE+LQ A +LE+R G Sbjct: 366 LMKAFFRARKFDQVQEVYKEMESAGCVPDRKAREMLQNALLILEQRHG 413 >ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Length = 494 Score = 70.5 bits (171), Expect = 8e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKA IRA+KFD+V IYEEM+SAGCTPDRKARE+LQTA VL++R Sbjct: 414 LMKACIRARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQR 459 >emb|CBI26569.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 70.5 bits (171), Expect = 8e-10 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKA IRA+KFD+V IYEEM+SAGCTPDRKARE+LQTA VL++R Sbjct: 335 LMKACIRARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQR 380 >ref|XP_006657333.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like, partial [Oryza brachyantha] Length = 389 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAF+RAKKF++V IY+EM+ AGCTPDRKARE+L AS +LE+R Sbjct: 341 LMKAFMRAKKFEKVSDIYKEMERAGCTPDRKAREMLNDASAILEQR 386 >ref|XP_004164250.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g36300-like [Cucumis sativus] Length = 433 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAFIRAKKF +V IY+EM+SAGCTPDRKARE+L++ + +LE+R Sbjct: 338 LMKAFIRAKKFAKVPEIYKEMESAGCTPDRKAREMLKSVTAILEQR 383 >ref|XP_004146932.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g36300-like [Cucumis sativus] Length = 455 Score = 68.9 bits (167), Expect = 2e-09 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAFIRAKKF +V IY+EM+SAGCTPDRKARE+L++ + +LE+R Sbjct: 338 LMKAFIRAKKFAKVPEIYKEMESAGCTPDRKAREMLKSVTAILEQR 383 >ref|NP_001174991.1| Os06g0710800 [Oryza sativa Japonica Group] gi|53792631|dbj|BAD53645.1| putative crp1 protein [Oryza sativa Japonica Group] gi|215693375|dbj|BAG88757.1| unnamed protein product [Oryza sativa Japonica Group] gi|255677390|dbj|BAH93719.1| Os06g0710800 [Oryza sativa Japonica Group] Length = 492 Score = 68.2 bits (165), Expect = 4e-09 Identities = 32/46 (69%), Positives = 40/46 (86%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAF+RAKKF++V +Y+EM+ AGCTPDRKARE+L AS VLE+R Sbjct: 442 LMKAFMRAKKFEKVSEVYKEMEGAGCTPDRKAREMLNDASIVLEQR 487 >ref|XP_006491815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] Length = 514 Score = 67.4 bits (163), Expect = 7e-09 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKRQ 746 LMKAFIRAKKF +V IY++M+S+GCTPDRKAR++LQ+A VLE+R+ Sbjct: 468 LMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR 514 >ref|XP_006428506.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|567871835|ref|XP_006428507.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|557530563|gb|ESR41746.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|557530564|gb|ESR41747.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] Length = 514 Score = 67.4 bits (163), Expect = 7e-09 Identities = 32/47 (68%), Positives = 42/47 (89%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKRQ 746 LMKAFIRAKKF +V IY++M+S+GCTPDRKAR++LQ+A VLE+R+ Sbjct: 468 LMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQRR 514 >ref|XP_006590461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 414 Score = 66.6 bits (161), Expect = 1e-08 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEK 752 LMKAFIRAKKFD+V IY+EM++ GCTPDRKAR++LQ A VLE+ Sbjct: 367 LMKAFIRAKKFDEVPIIYKEMENDGCTPDRKARQMLQVALTVLER 411 >ref|XP_002519998.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540762|gb|EEF42322.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 498 Score = 65.9 bits (159), Expect = 2e-08 Identities = 31/46 (67%), Positives = 39/46 (84%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKA+IRA+KFD+V IY EM+S+GCTPD+KARE+LQ A VL +R Sbjct: 412 LMKAYIRARKFDEVPEIYSEMESSGCTPDKKAREILQAALMVLGRR 457 >ref|XP_002437576.1| hypothetical protein SORBIDRAFT_10g029640 [Sorghum bicolor] gi|241915799|gb|EER88943.1| hypothetical protein SORBIDRAFT_10g029640 [Sorghum bicolor] Length = 429 Score = 65.1 bits (157), Expect = 4e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMK F+RAKKF++V +Y EM+ AGCTPDRKARE+L A+ VLE+R Sbjct: 366 LMKTFMRAKKFEKVSEVYREMERAGCTPDRKAREMLHDATVVLEQR 411 >gb|EXB29192.1| hypothetical protein L484_019727 [Morus notabilis] Length = 506 Score = 64.3 bits (155), Expect = 6e-08 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEK 752 LMKAFIRAKK D+V IY+EM+ AGCTPDRKAR++L+ A VLE+ Sbjct: 461 LMKAFIRAKKCDKVPEIYKEMECAGCTPDRKARQMLKVALNVLEQ 505 >gb|EYU45363.1| hypothetical protein MIMGU_mgv1a022626mg [Mimulus guttatus] Length = 432 Score = 63.2 bits (152), Expect = 1e-07 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMKAF+ AKKFDQV IY EM+++GC+PDRKARE+L++A LE+R Sbjct: 386 LMKAFLWAKKFDQVPKIYSEMEASGCSPDRKAREMLKSALIALEQR 431 >ref|XP_006573837.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Glycine max] gi|571436687|ref|XP_006573838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Glycine max] gi|571436689|ref|XP_006573839.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Glycine max] Length = 523 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEK 752 LMKAFIRAKKFD+V IY+EM++ CTPDRKAR++LQ A VLE+ Sbjct: 472 LMKAFIRAKKFDEVPIIYKEMENDRCTPDRKARQMLQVALMVLER 516 >gb|AFW69441.1| hypothetical protein ZEAMMB73_914225 [Zea mays] Length = 504 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMK F+RAKKF++V +Y EM+ AGC PDRKARE+L A+ VLE+R Sbjct: 444 LMKTFMRAKKFEKVSEVYREMERAGCAPDRKAREMLHDATVVLEQR 489 >ref|XP_003563545.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Brachypodium distachyon] Length = 492 Score = 63.2 bits (152), Expect = 1e-07 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 886 LMKAFIRAKKFDQVLGIYEEMQSAGCTPDRKARELLQTASGVLEKR 749 LMK F+R KKF++V +Y EM+ AGCTPDRKARE+L AS LE+R Sbjct: 444 LMKGFMRVKKFEKVSEVYNEMERAGCTPDRKAREMLHDASVTLEQR 489