BLASTX nr result
ID: Papaver27_contig00018800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00018800 (542 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007134837.1| hypothetical protein PHAVU_010G0804000g, par... 95 1e-17 ref|XP_007218112.1| hypothetical protein PRUPE_ppa006771mg [Prun... 95 1e-17 ref|XP_006347886.1| PREDICTED: methionine aminopeptidase 1A-like... 94 2e-17 ref|XP_004229798.1| PREDICTED: methionine aminopeptidase 1A-like... 94 2e-17 ref|XP_006445294.1| hypothetical protein CICLE_v10020473mg [Citr... 94 3e-17 ref|XP_006445293.1| hypothetical protein CICLE_v10020473mg [Citr... 94 3e-17 ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus... 93 5e-17 ref|XP_004514335.1| PREDICTED: methionine aminopeptidase 1A-like... 92 6e-17 ref|XP_004308462.1| PREDICTED: methionine aminopeptidase 1A-like... 92 6e-17 gb|AFK37517.1| unknown [Medicago truncatula] 92 6e-17 ref|XP_006573420.1| PREDICTED: methionine aminopeptidase 1A-like... 92 8e-17 ref|XP_004133928.1| PREDICTED: methionine aminopeptidase 1A-like... 92 8e-17 ref|XP_003517032.1| PREDICTED: methionine aminopeptidase 1A-like... 92 8e-17 ref|XP_007134838.1| hypothetical protein PHAVU_010G080500g [Phas... 92 1e-16 gb|EPS65207.1| methionine aminopeptidase, partial [Genlisea aurea] 92 1e-16 ref|XP_002320050.2| methionine aminopeptidase 1 family protein [... 91 1e-16 gb|ABK93110.1| unknown [Populus trichocarpa] 91 1e-16 gb|ABB91774.1| methionine aminopeptidase 1 [Ananas comosus] 91 2e-16 gb|EYU31593.1| hypothetical protein MIMGU_mgv1a021908mg, partial... 90 4e-16 ref|XP_006576425.1| PREDICTED: methionine aminopeptidase 1A-like... 90 4e-16 >ref|XP_007134837.1| hypothetical protein PHAVU_010G0804000g, partial [Phaseolus vulgaris] gi|561007882|gb|ESW06831.1| hypothetical protein PHAVU_010G0804000g, partial [Phaseolus vulgaris] Length = 209 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/49 (83%), Positives = 47/49 (95%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWTDVTADGKRSAQFEHTLLVT++GVEVLTGRL +SP VFPWL++ Sbjct: 161 MWPDGWTDVTADGKRSAQFEHTLLVTDTGVEVLTGRLQTSPSVFPWLNS 209 >ref|XP_007218112.1| hypothetical protein PRUPE_ppa006771mg [Prunus persica] gi|462414574|gb|EMJ19311.1| hypothetical protein PRUPE_ppa006771mg [Prunus persica] Length = 396 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKVFPWL+A Sbjct: 348 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVFPWLNA 396 >ref|XP_006347886.1| PREDICTED: methionine aminopeptidase 1A-like [Solanum tuberosum] Length = 402 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SPKVFPWL + Sbjct: 354 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLPTSPKVFPWLSS 402 >ref|XP_004229798.1| PREDICTED: methionine aminopeptidase 1A-like [Solanum lycopersicum] Length = 402 Score = 94.4 bits (233), Expect = 2e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SPKVFPWL + Sbjct: 354 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLPTSPKVFPWLSS 402 >ref|XP_006445294.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] gi|568875609|ref|XP_006490885.1| PREDICTED: methionine aminopeptidase 1A-like [Citrus sinensis] gi|557547556|gb|ESR58534.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] Length = 399 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+A Sbjct: 351 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA 399 >ref|XP_006445293.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] gi|557547555|gb|ESR58533.1| hypothetical protein CICLE_v10020473mg [Citrus clementina] Length = 370 Score = 93.6 bits (231), Expect = 3e-17 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+A Sbjct: 322 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLNA 370 >ref|XP_002511681.1| methionine aminopeptidase, putative [Ricinus communis] gi|223548861|gb|EEF50350.1| methionine aminopeptidase, putative [Ricinus communis] Length = 397 Score = 92.8 bits (229), Expect = 5e-17 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSP VFPWL+A Sbjct: 349 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPNVFPWLNA 397 >ref|XP_004514335.1| PREDICTED: methionine aminopeptidase 1A-like [Cicer arietinum] Length = 397 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 LWPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SP V+PWL++ Sbjct: 349 LWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLQTSPNVYPWLNS 397 >ref|XP_004308462.1| PREDICTED: methionine aminopeptidase 1A-like [Fragaria vesca subsp. vesca] Length = 393 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLD 144 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+ Sbjct: 345 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPSSPKVYPWLE 392 >gb|AFK37517.1| unknown [Medicago truncatula] Length = 397 Score = 92.4 bits (228), Expect = 6e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 LWPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SP V+PWL++ Sbjct: 349 LWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLPTSPNVYPWLNS 397 >ref|XP_006573420.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Glycine max] Length = 368 Score = 92.0 bits (227), Expect = 8e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWL 141 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SP VFPWL Sbjct: 320 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLQTSPNVFPWL 366 >ref|XP_004133928.1| PREDICTED: methionine aminopeptidase 1A-like [Cucumis sativus] gi|449528877|ref|XP_004171428.1| PREDICTED: methionine aminopeptidase 1A-like [Cucumis sativus] Length = 402 Score = 92.0 bits (227), Expect = 8e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLD 144 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL +SPKVFPWL+ Sbjct: 355 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTARLPTSPKVFPWLN 402 >ref|XP_003517032.1| PREDICTED: methionine aminopeptidase 1A-like isoform X1 [Glycine max] Length = 397 Score = 92.0 bits (227), Expect = 8e-17 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWL 141 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLTGRL +SP VFPWL Sbjct: 349 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTGRLQTSPNVFPWL 395 >ref|XP_007134838.1| hypothetical protein PHAVU_010G080500g [Phaseolus vulgaris] gi|561007883|gb|ESW06832.1| hypothetical protein PHAVU_010G080500g [Phaseolus vulgaris] Length = 397 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFEHTLLVT++GVEVLTGRL +SP VFPWL++ Sbjct: 349 MWPDGWTAVTADGKRSAQFEHTLLVTDTGVEVLTGRLQTSPNVFPWLNS 397 >gb|EPS65207.1| methionine aminopeptidase, partial [Genlisea aurea] Length = 400 Score = 91.7 bits (226), Expect = 1e-16 Identities = 41/45 (91%), Positives = 43/45 (95%) Frame = +1 Query: 4 WPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPW 138 WPDGWT VTADGKRSAQFEHTLLVT++GVEVLTGRL SSPKVFPW Sbjct: 356 WPDGWTAVTADGKRSAQFEHTLLVTDTGVEVLTGRLPSSPKVFPW 400 >ref|XP_002320050.2| methionine aminopeptidase 1 family protein [Populus trichocarpa] gi|550323634|gb|EEE98365.2| methionine aminopeptidase 1 family protein [Populus trichocarpa] Length = 397 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLD 144 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+ Sbjct: 349 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTTRLPSSPKVYPWLN 396 >gb|ABK93110.1| unknown [Populus trichocarpa] Length = 249 Score = 91.3 bits (225), Expect = 1e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLD 144 +WPDGWT VTADGKRSAQFEHTLLVTE+GVEVLT RL SSPKV+PWL+ Sbjct: 201 MWPDGWTAVTADGKRSAQFEHTLLVTETGVEVLTTRLPSSPKVYPWLN 248 >gb|ABB91774.1| methionine aminopeptidase 1 [Ananas comosus] Length = 395 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 LWPDGWT TADGKRSAQFEHTLLVTE+GVEVLT RL SSP VFPWL++ Sbjct: 346 LWPDGWTAATADGKRSAQFEHTLLVTETGVEVLTARLPSSPNVFPWLNS 394 >gb|EYU31593.1| hypothetical protein MIMGU_mgv1a021908mg, partial [Mimulus guttatus] gi|604321396|gb|EYU31972.1| hypothetical protein MIMGU_mgv1a0075711mg, partial [Mimulus guttatus] Length = 378 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWL 141 +WPDGWT VTADGKRSAQFEHTLLVT++GVEVLT RL SSP VFPWL Sbjct: 330 MWPDGWTAVTADGKRSAQFEHTLLVTDTGVEVLTARLPSSPNVFPWL 376 >ref|XP_006576425.1| PREDICTED: methionine aminopeptidase 1A-like isoform X2 [Glycine max] Length = 368 Score = 89.7 bits (221), Expect = 4e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 1 LWPDGWTDVTADGKRSAQFEHTLLVTESGVEVLTGRLASSPKVFPWLDA 147 +WPDGWT VTADGKRSAQFE TLLVTE+GVEVLTGRL +SP VFPWL++ Sbjct: 320 MWPDGWTAVTADGKRSAQFEQTLLVTETGVEVLTGRLQTSPNVFPWLNS 368