BLASTX nr result
ID: Papaver27_contig00018281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00018281 (469 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006355780.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-18 emb|CBI39605.3| unnamed protein product [Vitis vinifera] 97 3e-18 ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] 97 3e-18 ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containi... 96 4e-18 ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily p... 96 7e-18 ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containi... 95 9e-18 ref|XP_002322762.2| hypothetical protein POPTR_0016s06560g [Popu... 95 1e-17 ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citr... 94 2e-17 emb|CBI28813.3| unnamed protein product [Vitis vinifera] 94 2e-17 ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Caps... 93 4e-17 ref|XP_002873264.1| pentatricopeptide repeat-containing protein ... 93 4e-17 emb|CBI39100.3| unnamed protein product [Vitis vinifera] 93 4e-17 ref|XP_002267596.1| PREDICTED: pentatricopeptide repeat-containi... 93 4e-17 gb|EYU44055.1| hypothetical protein MIMGU_mgv1a002435mg [Mimulus... 92 6e-17 ref|XP_007203470.1| hypothetical protein PRUPE_ppa024598mg [Prun... 92 6e-17 ref|XP_003588753.1| Pentatricopeptide repeat-containing protein ... 92 6e-17 ref|XP_006443657.1| hypothetical protein CICLE_v10019256mg [Citr... 92 7e-17 ref|XP_007041101.1| Tetratricopeptide repeat (TPR)-like superfam... 92 7e-17 >ref|XP_006355780.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Solanum tuberosum] Length = 602 Score = 97.4 bits (241), Expect = 2e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRI+KNLRVC DCHTATKLISR+Y+REIIVRDR RFH FRNG CSC+D+W Sbjct: 553 IRIIKNLRVCNDCHTATKLISRIYEREIIVRDRSRFHHFRNGTCSCLDYW 602 >emb|CBI39605.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCH+ATKLIS+VY REIIVRDR+R+H FRNG CSC DFW Sbjct: 575 IRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 624 >ref|XP_002281942.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910 isoform 1 [Vitis vinifera] Length = 672 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCH+ATKLIS+VY REIIVRDR+R+H FRNG CSC DFW Sbjct: 623 IRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 672 >emb|CAN61593.1| hypothetical protein VITISV_030555 [Vitis vinifera] Length = 673 Score = 96.7 bits (239), Expect = 3e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCH+ATKLIS+VY REIIVRDR+R+H FRNG CSC DFW Sbjct: 624 IRIVKNLRVCEDCHSATKLISQVYNREIIVRDRIRYHHFRNGACSCKDFW 673 >ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Solanum lycopersicum] Length = 602 Score = 96.3 bits (238), Expect = 4e-18 Identities = 40/50 (80%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRI+KNLRVC DCHTATKLISR+Y+REIIVRDR RFH F+NG CSC+D+W Sbjct: 553 IRIIKNLRVCNDCHTATKLISRIYEREIIVRDRSRFHHFKNGTCSCLDYW 602 >ref|XP_007029178.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508717783|gb|EOY09680.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 626 Score = 95.5 bits (236), Expect = 7e-18 Identities = 41/50 (82%), Positives = 47/50 (94%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCHTATKLIS+V++RE+IVRDR RFH FR+G CSCMD+W Sbjct: 577 IRIVKNLRVCEDCHTATKLISKVFERELIVRDRNRFHHFRHGTCSCMDYW 626 >ref|XP_004288820.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Fragaria vesca subsp. vesca] Length = 659 Score = 95.1 bits (235), Expect = 9e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IR+VKNLRVC DCHTATKLIS+VY REIIVRDR RFHQF++G+CSC DFW Sbjct: 610 IRVVKNLRVCSDCHTATKLISKVYNREIIVRDRNRFHQFKDGSCSCKDFW 659 >ref|XP_002322762.2| hypothetical protein POPTR_0016s06560g [Populus trichocarpa] gi|550320988|gb|EEF04523.2| hypothetical protein POPTR_0016s06560g [Populus trichocarpa] Length = 543 Score = 94.7 bits (234), Expect = 1e-17 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCHTATKLIS+VY+RE+IVRDR RFH F+ G CSCMD+W Sbjct: 494 IRIVKNLRVCEDCHTATKLISKVYERELIVRDRNRFHHFKGGACSCMDYW 543 >ref|XP_006433546.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] gi|557535668|gb|ESR46786.1| hypothetical protein CICLE_v10003403mg [Citrus clementina] Length = 558 Score = 94.0 bits (232), Expect = 2e-17 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IR++KNLRVCEDCH+ATKLI +V+KR+IIVRDRVR+H FRNG CSC DFW Sbjct: 509 IRVIKNLRVCEDCHSATKLIFKVFKRDIIVRDRVRYHHFRNGKCSCNDFW 558 >emb|CBI28813.3| unnamed protein product [Vitis vinifera] Length = 500 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRI KNLRVC DCH+ATKLIS++Y REIIVRDR RFH FR+G+CSCMDFW Sbjct: 451 IRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 500 >ref|XP_002269269.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vitis vinifera] Length = 640 Score = 94.0 bits (232), Expect = 2e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRI KNLRVC DCH+ATKLIS++Y REIIVRDR RFH FR+G+CSCMDFW Sbjct: 591 IRITKNLRVCADCHSATKLISKIYNREIIVRDRCRFHHFRDGSCSCMDFW 640 >ref|XP_006289319.1| hypothetical protein CARUB_v10002804mg [Capsella rubella] gi|482558025|gb|EOA22217.1| hypothetical protein CARUB_v10002804mg [Capsella rubella] Length = 622 Score = 92.8 bits (229), Expect = 4e-17 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCHT TKLIS VY RE IVRDR RFH FRNG+CSC D+W Sbjct: 573 IRIVKNLRVCEDCHTVTKLISEVYGREFIVRDRNRFHHFRNGSCSCRDYW 622 >ref|XP_002873264.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319101|gb|EFH49523.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 624 Score = 92.8 bits (229), Expect = 4e-17 Identities = 42/50 (84%), Positives = 43/50 (86%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCHTATKLIS VY RE IVRDR RFH FRNG CSC D+W Sbjct: 575 IRIVKNLRVCEDCHTATKLISEVYGREFIVRDRNRFHHFRNGLCSCRDYW 624 >emb|CBI39100.3| unnamed protein product [Vitis vinifera] Length = 483 Score = 92.8 bits (229), Expect = 4e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCHTATKLIS+V+ RE+IVRDR RFH FR G CSCMD+W Sbjct: 434 IRIVKNLRVCEDCHTATKLISKVFGRELIVRDRNRFHHFRQGLCSCMDYW 483 >ref|XP_002267596.1| PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Vitis vinifera] Length = 623 Score = 92.8 bits (229), Expect = 4e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCHTATKLIS+V+ RE+IVRDR RFH FR G CSCMD+W Sbjct: 574 IRIVKNLRVCEDCHTATKLISKVFGRELIVRDRNRFHHFRQGLCSCMDYW 623 >gb|EYU44055.1| hypothetical protein MIMGU_mgv1a002435mg [Mimulus guttatus] Length = 675 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCH+ K+ISRVY REIIVRDRVR+H FR G CSC DFW Sbjct: 626 IRIVKNLRVCEDCHSVAKIISRVYDREIIVRDRVRYHHFRRGQCSCKDFW 675 >ref|XP_007203470.1| hypothetical protein PRUPE_ppa024598mg [Prunus persica] gi|462399001|gb|EMJ04669.1| hypothetical protein PRUPE_ppa024598mg [Prunus persica] Length = 722 Score = 92.4 bits (228), Expect = 6e-17 Identities = 39/50 (78%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IR+VKNLRVC DCHTATK+IS+VY REIIVRDR RFH+F++G+CSC DFW Sbjct: 673 IRVVKNLRVCSDCHTATKIISKVYNREIIVRDRNRFHRFQDGSCSCKDFW 722 >ref|XP_003588753.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355477801|gb|AES59004.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 600 Score = 92.4 bits (228), Expect = 6e-17 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IRIVKNLRVCEDCH+ATK IS+VY REI+VRDR RFH F+NG CSC DFW Sbjct: 551 IRIVKNLRVCEDCHSATKFISKVYNREIVVRDRNRFHHFKNGLCSCRDFW 600 >ref|XP_006443657.1| hypothetical protein CICLE_v10019256mg [Citrus clementina] gi|568853066|ref|XP_006480188.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Citrus sinensis] gi|557545919|gb|ESR56897.1| hypothetical protein CICLE_v10019256mg [Citrus clementina] Length = 642 Score = 92.0 bits (227), Expect = 7e-17 Identities = 37/50 (74%), Positives = 46/50 (92%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 +RIVKNLR+CEDCH++ KLIS++YKR+IIVRDR RFH F NG+CSCMD+W Sbjct: 593 LRIVKNLRICEDCHSSLKLISKIYKRKIIVRDRKRFHHFENGSCSCMDYW 642 >ref|XP_007041101.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590681507|ref|XP_007041102.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590681511|ref|XP_007041103.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705036|gb|EOX96932.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705037|gb|EOX96933.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508705038|gb|EOX96934.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 616 Score = 92.0 bits (227), Expect = 7e-17 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = +2 Query: 2 IRIVKNLRVCEDCHTATKLISRVYKREIIVRDRVRFHQFRNGNCSCMDFW 151 IR+VKNLRVC DCH A KL+S+V+KREII+RDR RFH FRNG+CSCMD+W Sbjct: 567 IRVVKNLRVCADCHMAIKLLSKVFKREIIIRDRSRFHHFRNGSCSCMDYW 616