BLASTX nr result
ID: Papaver27_contig00017851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00017851 (1266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264270.1| PREDICTED: putative vesicle-associated membr... 59 4e-06 emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera] 59 4e-06 ref|XP_007034428.1| Vesicle-associated membrane 721, VAMP7B-like... 58 8e-06 ref|XP_007034426.1| Vesicle-associated membrane protein 721, VAM... 58 1e-05 ref|XP_007034425.1| Vesicle-associated membrane protein 726 isof... 58 1e-05 ref|XP_007034424.1| Vesicle-associated membrane protein 726 isof... 58 1e-05 tpg|DAA42468.1| TPA: putative vesicle-associated membrane protei... 58 1e-05 >ref|XP_002264270.1| PREDICTED: putative vesicle-associated membrane protein 726 [Vitis vinifera] gi|296090506|emb|CBI40837.3| unnamed protein product [Vitis vinifera] Length = 220 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 NSAAYCVVAVESAGRQVPIAFLERVKDDFNK 1 N YCVVAVESAGRQ+PIAFLERVKDDFNK Sbjct: 62 NGFTYCVVAVESAGRQIPIAFLERVKDDFNK 92 >emb|CAN65946.1| hypothetical protein VITISV_029427 [Vitis vinifera] Length = 200 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 NSAAYCVVAVESAGRQVPIAFLERVKDDFNK 1 N YCVVAVESAGRQ+PIAFLERVKDDFNK Sbjct: 42 NGFTYCVVAVESAGRQIPIAFLERVKDDFNK 72 >ref|XP_007034428.1| Vesicle-associated membrane 721, VAMP7B-like protein [Theobroma cacao] gi|508713457|gb|EOY05354.1| Vesicle-associated membrane 721, VAMP7B-like protein [Theobroma cacao] Length = 257 Score = 58.2 bits (139), Expect = 8e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -1 Query: 132 QSFVLFVRFLCFMNSAAYCVVAVESAGRQVPIAFLERVKDDFNK 1 +SF +RF AYCVVAVESAGRQVPIAFLERVK+DFN+ Sbjct: 152 KSFRFVIRFFSLR---AYCVVAVESAGRQVPIAFLERVKEDFNE 192 >ref|XP_007034426.1| Vesicle-associated membrane protein 721, VAMP7B [Theobroma cacao] gi|508713455|gb|EOY05352.1| Vesicle-associated membrane protein 721, VAMP7B [Theobroma cacao] Length = 104 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -1 Query: 84 AYCVVAVESAGRQVPIAFLERVKDDFNK 1 AYCVVAVESAGRQVPIAFLERVK+DFNK Sbjct: 7 AYCVVAVESAGRQVPIAFLERVKEDFNK 34 >ref|XP_007034425.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma cacao] gi|508713454|gb|EOY05351.1| Vesicle-associated membrane protein 726 isoform 2 [Theobroma cacao] Length = 219 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 NSAAYCVVAVESAGRQVPIAFLERVKDDFNK 1 N YCVVAVESAGRQVPIAFLERVK+DFNK Sbjct: 61 NGFTYCVVAVESAGRQVPIAFLERVKEDFNK 91 >ref|XP_007034424.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma cacao] gi|508713453|gb|EOY05350.1| Vesicle-associated membrane protein 726 isoform 1 [Theobroma cacao] Length = 219 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -1 Query: 93 NSAAYCVVAVESAGRQVPIAFLERVKDDFNK 1 N YCVVAVESAGRQVPIAFLERVK+DFNK Sbjct: 61 NGFTYCVVAVESAGRQVPIAFLERVKEDFNK 91 >tpg|DAA42468.1| TPA: putative vesicle-associated membrane protein family protein [Zea mays] Length = 168 Score = 57.8 bits (138), Expect = 1e-05 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -1 Query: 114 VRFLCFMNSAAYCVVAVESAGRQVPIAFLERVKDDFNK 1 + +CF SAAYCVVAVES GRQ+PIAFL+RVK+DF K Sbjct: 2 INIVCF--SAAYCVVAVESVGRQIPIAFLDRVKEDFTK 37