BLASTX nr result
ID: Papaver27_contig00017666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00017666 (562 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78943.1| hypothetical protein (mitochondrion) [Vicia faba] 64 4e-08 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 60 3e-07 gb|EPS74490.1| hypothetical protein M569_00256 [Genlisea aurea] 57 3e-06 >gb|AGC78943.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 135 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +2 Query: 287 DQHAAVNLYPGPVHTARHTL*IGFTRSIGSMIT 385 DQHAAVN+YPGPVHTARHTL IGF RSIG MIT Sbjct: 73 DQHAAVNMYPGPVHTARHTLGIGFARSIGPMIT 105 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 287 DQHAAVNLYPGPVHTARHTL*IGFTRSIGSMIT 385 DQHAAVN+YPGPVHTARHTL IGF RSI MIT Sbjct: 475 DQHAAVNMYPGPVHTARHTLGIGFARSIRPMIT 507 >gb|EPS74490.1| hypothetical protein M569_00256 [Genlisea aurea] Length = 184 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +2 Query: 290 QHAAVNLYPGPVHTARHTL*IGFTRSIGSMI 382 QHAAVN+YPGPVHTARHTL IGF RSIG I Sbjct: 123 QHAAVNMYPGPVHTARHTLGIGFARSIGPTI 153