BLASTX nr result
ID: Papaver27_contig00017556
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00017556 (451 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315263.1| immunophilin family protein [Populus trichoc... 56 4e-06 ref|XP_007218465.1| hypothetical protein PRUPE_ppa011919mg [Prun... 56 6e-06 ref|XP_002312056.1| hypothetical protein POPTR_0008s04760g [Popu... 55 1e-05 >ref|XP_002315263.1| immunophilin family protein [Populus trichocarpa] gi|222864303|gb|EEF01434.1| immunophilin family protein [Populus trichocarpa] Length = 213 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 105 DSFENKLAQVRLRYKSGTGKKAELRKGKKSKGTNG 1 D FE++L+QVRLRY+SGTGKKAELRK KK K ++G Sbjct: 59 DQFESRLSQVRLRYRSGTGKKAELRKAKKGKSSSG 93 >ref|XP_007218465.1| hypothetical protein PRUPE_ppa011919mg [Prunus persica] gi|462414927|gb|EMJ19664.1| hypothetical protein PRUPE_ppa011919mg [Prunus persica] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 105 DSFENKLAQVRLRYKSGTGKKAELRKGKKSKGTNG 1 D F++KL+QVRLRY+SGTGKKAELRK KKSK +G Sbjct: 56 DDFDSKLSQVRLRYRSGTGKKAELRKTKKSKSGSG 90 >ref|XP_002312056.1| hypothetical protein POPTR_0008s04760g [Populus trichocarpa] gi|566182380|ref|XP_006379563.1| immunophilin family protein [Populus trichocarpa] gi|222851876|gb|EEE89423.1| hypothetical protein POPTR_0008s04760g [Populus trichocarpa] gi|550332434|gb|ERP57360.1| immunophilin family protein [Populus trichocarpa] Length = 199 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -2 Query: 105 DSFENKLAQVRLRYKSGTGKKAELRKGKKSKGTNG 1 D FE++L+QVRLRY+SGTGKKAELRK KK K +G Sbjct: 67 DQFESRLSQVRLRYRSGTGKKAELRKAKKGKSGSG 101