BLASTX nr result
ID: Papaver27_contig00017518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00017518 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006299795.1| hypothetical protein CARUB_v10015991mg [Caps... 65 1e-08 ref|XP_006296689.1| hypothetical protein CARUB_v10013264mg [Caps... 65 1e-08 gb|EXB80294.1| ABC transporter E family member 2 [Morus notabilis] 65 1e-08 ref|XP_007222049.1| hypothetical protein PRUPE_ppa003094mg [Prun... 65 1e-08 ref|XP_007217624.1| hypothetical protein PRUPE_ppa015638mg [Prun... 65 1e-08 ref|XP_007216970.1| hypothetical protein PRUPE_ppa003087mg [Prun... 65 1e-08 emb|CBI29193.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002271392.1| PREDICTED: ABC transporter E family member 2... 65 1e-08 emb|CAN65893.1| hypothetical protein VITISV_021090 [Vitis vinifera] 65 1e-08 ref|XP_002882833.1| hypothetical protein ARALYDRAFT_897595 [Arab... 64 2e-08 ref|XP_007158074.1| hypothetical protein PHAVU_002G121800g [Phas... 64 3e-08 ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citr... 64 3e-08 ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citr... 64 3e-08 gb|EPS64099.1| hypothetical protein M569_10682, partial [Genlise... 64 3e-08 tpg|DAA45214.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea m... 64 3e-08 tpg|DAA45212.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea m... 64 3e-08 ref|XP_003580843.1| PREDICTED: ABC transporter E family member 2... 64 3e-08 ref|XP_003537713.1| PREDICTED: ABC transporter E family member 2... 64 3e-08 ref|XP_002516768.1| rnase l inhibitor, putative [Ricinus communi... 64 3e-08 ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communi... 64 3e-08 >ref|XP_006299795.1| hypothetical protein CARUB_v10015991mg [Capsella rubella] gi|482568504|gb|EOA32693.1| hypothetical protein CARUB_v10015991mg [Capsella rubella] Length = 603 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS L+IT R D TNFRP INKLEST+DKEQKA+GSYYYL+ Sbjct: 563 LSHLNITFRRDPTNFRPRINKLESTKDKEQKAAGSYYYLD 602 >ref|XP_006296689.1| hypothetical protein CARUB_v10013264mg [Capsella rubella] gi|482565398|gb|EOA29587.1| hypothetical protein CARUB_v10013264mg [Capsella rubella] Length = 603 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS L+IT R D TNFRP INKLEST+DKEQKA+GSYYYL+ Sbjct: 563 LSHLNITFRRDPTNFRPRINKLESTKDKEQKAAGSYYYLD 602 >gb|EXB80294.1| ABC transporter E family member 2 [Morus notabilis] Length = 605 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKLEST+D+EQK++GSYYYL+ Sbjct: 565 LSHLDITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLD 604 >ref|XP_007222049.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica] gi|462418985|gb|EMJ23248.1| hypothetical protein PRUPE_ppa003094mg [Prunus persica] Length = 605 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TN+RP INKLEST+D+EQKA+GSYYYL+ Sbjct: 565 LSHLDITFRRDPTNYRPRINKLESTKDREQKAAGSYYYLD 604 >ref|XP_007217624.1| hypothetical protein PRUPE_ppa015638mg [Prunus persica] gi|462413774|gb|EMJ18823.1| hypothetical protein PRUPE_ppa015638mg [Prunus persica] Length = 601 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LSQLDIT R D TN+RP INKL ST+D+EQKA+GSYYYL+ Sbjct: 561 LSQLDITFRRDPTNYRPRINKLNSTKDREQKAAGSYYYLD 600 >ref|XP_007216970.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica] gi|462413120|gb|EMJ18169.1| hypothetical protein PRUPE_ppa003087mg [Prunus persica] Length = 605 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TN+RP INKLEST+D+EQKA+GSYYYL+ Sbjct: 565 LSHLDITFRRDPTNYRPRINKLESTKDREQKAAGSYYYLD 604 >emb|CBI29193.3| unnamed protein product [Vitis vinifera] Length = 625 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKLEST+D+EQK++GSYYYL+ Sbjct: 585 LSHLDITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLD 624 >ref|XP_002271392.1| PREDICTED: ABC transporter E family member 2 [Vitis vinifera] Length = 605 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKLEST+D+EQK++GSYYYL+ Sbjct: 565 LSHLDITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLD 604 >emb|CAN65893.1| hypothetical protein VITISV_021090 [Vitis vinifera] Length = 599 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKLEST+D+EQK++GSYYYL+ Sbjct: 559 LSHLDITFRRDPTNFRPRINKLESTKDREQKSAGSYYYLD 598 >ref|XP_002882833.1| hypothetical protein ARALYDRAFT_897595 [Arabidopsis lyrata subsp. lyrata] gi|297328673|gb|EFH59092.1| hypothetical protein ARALYDRAFT_897595 [Arabidopsis lyrata subsp. lyrata] Length = 69 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS L+IT R D TNFRP INKLEST+D+EQKA+GSYYYL+ Sbjct: 29 LSHLNITFRRDPTNFRPRINKLESTKDREQKAAGSYYYLD 68 >ref|XP_007158074.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris] gi|561031489|gb|ESW30068.1| hypothetical protein PHAVU_002G121800g [Phaseolus vulgaris] Length = 606 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKL+ST+D+EQK++GSYYYL+ Sbjct: 566 LSHLDITFRRDPTNFRPRINKLDSTKDREQKSAGSYYYLD 605 >ref|XP_006430899.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|567876621|ref|XP_006430900.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|568857601|ref|XP_006482353.1| PREDICTED: ABC transporter E family member 2-like [Citrus sinensis] gi|557532956|gb|ESR44139.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|557532957|gb|ESR44140.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] Length = 605 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKL+ST+D++QKA+GSYYYL+ Sbjct: 565 LSHLDITFRRDPTNFRPRINKLDSTKDRDQKAAGSYYYLD 604 >ref|XP_006430898.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] gi|557532955|gb|ESR44138.1| hypothetical protein CICLE_v10011325mg [Citrus clementina] Length = 584 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKL+ST+D++QKA+GSYYYL+ Sbjct: 544 LSHLDITFRRDPTNFRPRINKLDSTKDRDQKAAGSYYYLD 583 >gb|EPS64099.1| hypothetical protein M569_10682, partial [Genlisea aurea] Length = 608 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKL+ST+D+EQK++GSYYYL+ Sbjct: 568 LSHLDITFRRDPTNFRPRINKLDSTKDREQKSAGSYYYLD 607 >tpg|DAA45214.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays] Length = 550 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TN+RP INKLEST+D+EQK++GSYYYL+ Sbjct: 510 LSHLDITFRRDPTNYRPRINKLESTKDREQKSAGSYYYLD 549 >tpg|DAA45212.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays] gi|414866656|tpg|DAA45213.1| TPA: hypothetical protein ZEAMMB73_266266 [Zea mays] Length = 604 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TN+RP INKLEST+D+EQK++GSYYYL+ Sbjct: 564 LSHLDITFRRDPTNYRPRINKLESTKDREQKSAGSYYYLD 603 >ref|XP_003580843.1| PREDICTED: ABC transporter E family member 2-like [Brachypodium distachyon] Length = 604 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TN+RP INKLEST+D+EQK++GSYYYL+ Sbjct: 564 LSHLDITFRRDPTNYRPRINKLESTKDREQKSAGSYYYLD 603 >ref|XP_003537713.1| PREDICTED: ABC transporter E family member 2-like [Glycine max] Length = 606 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKL+ST+D+EQK++GSYYYL+ Sbjct: 566 LSHLDITFRRDPTNFRPRINKLDSTKDREQKSAGSYYYLD 605 >ref|XP_002516768.1| rnase l inhibitor, putative [Ricinus communis] gi|223544141|gb|EEF45666.1| rnase l inhibitor, putative [Ricinus communis] Length = 126 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TN+RP INKL+ST+D+EQKA+GSYYYL+ Sbjct: 86 LSHLDITFRRDPTNYRPKINKLDSTKDREQKAAGSYYYLD 125 >ref|XP_002528281.1| rnase l inhibitor, putative [Ricinus communis] gi|223532318|gb|EEF34119.1| rnase l inhibitor, putative [Ricinus communis] Length = 591 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -3 Query: 411 LSQLDITLRWDSTNFRPWINKLESTQDKEQKASGSYYYLE 292 LS LDIT R D TNFRP INKL+ST+D++QKA+GSYYYL+ Sbjct: 551 LSHLDITFRRDPTNFRPRINKLDSTKDRDQKAAGSYYYLD 590