BLASTX nr result
ID: Papaver27_contig00016426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00016426 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA33132.1| hybrid proline-rich protein;cytokinin-induced;hau... 70 2e-10 gb|AEO79030.1| PRP1 precursor [Capsicum annuum] 70 3e-10 ref|XP_006353733.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 69 5e-10 ref|XP_004243657.1| PREDICTED: 36.4 kDa proline-rich protein iso... 69 5e-10 sp|Q00451.1|PRF1_SOLLC RecName: Full=36.4 kDa proline-rich prote... 69 5e-10 gb|ADW66157.1| proline-rich protein [Solanum nigrum] 69 5e-10 emb|CAA40361.1| proline rich protein [Solanum lycopersicum] 69 5e-10 gb|AAC49600.2| putative proline-rich protein [Solanum palustre] 69 5e-10 ref|XP_007216673.1| hypothetical protein PRUPE_ppb004684mg [Prun... 69 7e-10 gb|AEO92077.1| hybrid proline-rich protein [Nicotiana tabacum] 69 7e-10 ref|XP_002520567.1| Repetitive proline-rich cell wall protein 2 ... 69 7e-10 gb|ABR13301.1| putative proline-rich cell wall protein [Prunus d... 69 7e-10 gb|EYU42870.1| hypothetical protein MIMGU_mgv1a011120mg [Mimulus... 68 1e-09 ref|XP_004166254.1| PREDICTED: 36.4 kDa proline-rich protein-lik... 68 1e-09 ref|XP_004146070.1| PREDICTED: uncharacterized protein LOC101218... 68 1e-09 ref|XP_007049067.1| Bifunctional inhibitor/lipid-transfer protei... 67 2e-09 ref|XP_007049066.1| Bifunctional inhibitor/lipid-transfer protei... 67 2e-09 ref|XP_004502092.1| PREDICTED: repetitive proline-rich cell wall... 67 2e-09 gb|AEO79031.1| PRP1 precursor [Nicotiana benthamiana] 67 3e-09 gb|AAC06386.1| proline rich protein, partial [Malus domestica] 67 3e-09 >gb|AAA33132.1| hybrid proline-rich protein;cytokinin-induced;haustoria [Cuscuta reflexa] Length = 329 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 A +CLCT I+AKLLN+NI+LPIAL+VLIDDCG PP+GF C Sbjct: 285 AGICLCTTIKAKLLNINIILPIALQVLIDDCGMIPPAGFQC 325 >gb|AEO79030.1| PRP1 precursor [Capsicum annuum] Length = 387 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VL+DDCGK+PP F C Sbjct: 344 AAICLCTTIRLKLLNINIILPIALQVLVDDCGKHPPKDFQC 384 >ref|XP_006353733.1| PREDICTED: 36.4 kDa proline-rich protein-like [Solanum tuberosum] Length = 390 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VLIDDCGK PP F C Sbjct: 347 AAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 387 >ref|XP_004243657.1| PREDICTED: 36.4 kDa proline-rich protein isoform 1 [Solanum lycopersicum] gi|460396183|ref|XP_004243658.1| PREDICTED: 36.4 kDa proline-rich protein isoform 2 [Solanum lycopersicum] Length = 364 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VLIDDCGK PP F C Sbjct: 321 AAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 361 >sp|Q00451.1|PRF1_SOLLC RecName: Full=36.4 kDa proline-rich protein gi|19390|emb|CAA43666.1| proline rich protein [Solanum lycopersicum] Length = 346 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VLIDDCGK PP F C Sbjct: 303 AAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 343 >gb|ADW66157.1| proline-rich protein [Solanum nigrum] Length = 89 Score = 69.3 bits (168), Expect = 5e-10 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+ KLLN+NI+LPIAL+VL+DDCGK PP F C Sbjct: 47 AAICLCTTIKLKLLNINIILPIALQVLVDDCGKYPPKDFKC 87 >emb|CAA40361.1| proline rich protein [Solanum lycopersicum] Length = 313 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VLIDDCGK PP F C Sbjct: 270 AAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 310 >gb|AAC49600.2| putative proline-rich protein [Solanum palustre] Length = 407 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VLIDDCGK PP F C Sbjct: 364 AAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 404 >ref|XP_007216673.1| hypothetical protein PRUPE_ppb004684mg [Prunus persica] gi|462412823|gb|EMJ17872.1| hypothetical protein PRUPE_ppb004684mg [Prunus persica] Length = 446 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+NI++PIAL+VLI DCGK PPSGF C Sbjct: 405 AAICLCTTIKAKLLNINIIIPIALQVLI-DCGKTPPSGFQC 444 >gb|AEO92077.1| hybrid proline-rich protein [Nicotiana tabacum] Length = 367 Score = 68.9 bits (167), Expect = 7e-10 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLLN+NI+LPIAL+VL+DDCGK PP F C Sbjct: 324 AAICLCTTIRLKLLNINIILPIALQVLVDDCGKYPPKDFKC 364 >ref|XP_002520567.1| Repetitive proline-rich cell wall protein 2 precursor, putative [Ricinus communis] gi|223540227|gb|EEF41800.1| Repetitive proline-rich cell wall protein 2 precursor, putative [Ricinus communis] Length = 299 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AALCLCT I+AKLLN+NI++PIAL+VL+ DCGKNPP GF C Sbjct: 258 AALCLCTTIKAKLLNLNIIIPIALEVLV-DCGKNPPPGFQC 297 >gb|ABR13301.1| putative proline-rich cell wall protein [Prunus dulcis] Length = 130 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+NI++PIAL+VLI DCGK PPSGF C Sbjct: 89 AAICLCTTIKAKLLNINIIIPIALQVLI-DCGKTPPSGFQC 128 >gb|EYU42870.1| hypothetical protein MIMGU_mgv1a011120mg [Mimulus guttatus] Length = 292 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AALCLCTAI+AKLLN+NI++PIAL+VL+ DCGK PP GF C Sbjct: 251 AALCLCTAIKAKLLNINILIPIALQVLV-DCGKTPPYGFQC 290 >ref|XP_004166254.1| PREDICTED: 36.4 kDa proline-rich protein-like, partial [Cucumis sativus] Length = 143 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/41 (70%), Positives = 38/41 (92%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+N+++PIAL+VL+ DCGK+PPSGF C Sbjct: 101 AAVCLCTTIKAKLLNINLIIPIALQVLV-DCGKHPPSGFQC 140 >ref|XP_004146070.1| PREDICTED: uncharacterized protein LOC101218239 [Cucumis sativus] Length = 254 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/41 (70%), Positives = 38/41 (92%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+N+++PIAL+VL+ DCGK+PPSGF C Sbjct: 212 AAVCLCTTIKAKLLNINLIIPIALQVLV-DCGKHPPSGFQC 251 >ref|XP_007049067.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein isoform 2, partial [Theobroma cacao] gi|590711302|ref|XP_007049068.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein isoform 2, partial [Theobroma cacao] gi|508701328|gb|EOX93224.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein isoform 2, partial [Theobroma cacao] gi|508701329|gb|EOX93225.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein isoform 2, partial [Theobroma cacao] Length = 393 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+NI++PIAL+VL+ DCGK PP+GF C Sbjct: 352 AAICLCTTIKAKLLNINIIIPIALQVLV-DCGKTPPAGFQC 391 >ref|XP_007049066.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein isoform 1 [Theobroma cacao] gi|508701327|gb|EOX93223.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein isoform 1 [Theobroma cacao] Length = 419 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+NI++PIAL+VL+ DCGK PP+GF C Sbjct: 378 AAICLCTTIKAKLLNINIIIPIALQVLV-DCGKTPPAGFQC 417 >ref|XP_004502092.1| PREDICTED: repetitive proline-rich cell wall protein 2-like [Cicer arietinum] Length = 419 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AALCLCT+I+ KLLN+N+V+PIAL++LI DCGKNPP GF C Sbjct: 378 AALCLCTSIKLKLLNINLVIPIALQLLI-DCGKNPPEGFKC 417 >gb|AEO79031.1| PRP1 precursor [Nicotiana benthamiana] Length = 325 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I KLL++NI+LPIAL+VL+DDCGK PP F C Sbjct: 282 AAICLCTTIRLKLLSINIILPIALQVLVDDCGKYPPKDFKC 322 >gb|AAC06386.1| proline rich protein, partial [Malus domestica] Length = 75 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +3 Query: 3 AALCLCTAIEAKLLNVNIVLPIALKVLIDDCGKNPPSGFTC 125 AA+CLCT I+AKLLN+N+++PI L+VLI DCGK PPSGF C Sbjct: 34 AAICLCTTIKAKLLNINLIIPIVLQVLI-DCGKTPPSGFQC 73