BLASTX nr result
ID: Papaver27_contig00014342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00014342 (522 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528682.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 >ref|XP_002528682.1| conserved hypothetical protein [Ricinus communis] gi|223531905|gb|EEF33721.1| conserved hypothetical protein [Ricinus communis] Length = 364 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 43 SCISKKDRCSAKEALDKLRESGWTKDWSSQPYVSQR 150 + I+KKD + KEALD+LRE GW K+WSSQPYVS+R Sbjct: 43 AAIAKKDSNAVKEALDQLREDGWAKNWSSQPYVSRR 78