BLASTX nr result
ID: Papaver27_contig00014251
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00014251 (569 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006381628.1| hypothetical protein POPTR_0006s14470g, part... 57 3e-06 >ref|XP_006381628.1| hypothetical protein POPTR_0006s14470g, partial [Populus trichocarpa] gi|550336336|gb|ERP59425.1| hypothetical protein POPTR_0006s14470g, partial [Populus trichocarpa] Length = 82 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 564 LGDQSSNLARHSIHFLKRTDAERFISLGLMEELSG 460 L D+++NLARHS+HFLKRTDAE++I+ GLMEEL+G Sbjct: 48 LSDKTANLARHSMHFLKRTDAEQYIARGLMEELTG 82