BLASTX nr result
ID: Papaver27_contig00012917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00012917 (511 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA69622.1| cyclophylin [Digitalis lanata] 58 1e-06 emb|CAA69598.1| cyclophilin [Digitalis lanata] 58 2e-06 >emb|CAA69622.1| cyclophylin [Digitalis lanata] Length = 172 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 509 GMDVVRAIEKVGSQSGKCKVPVVVADCGQIC 417 GMDVVRAIEKVGSQSGK PVV+ADCGQIC Sbjct: 142 GMDVVRAIEKVGSQSGKTAKPVVIADCGQIC 172 >emb|CAA69598.1| cyclophilin [Digitalis lanata] Length = 172 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 509 GMDVVRAIEKVGSQSGKCKVPVVVADCGQIC 417 GMDVVRAIEKVGSQSGK PVVVADCGQ+C Sbjct: 142 GMDVVRAIEKVGSQSGKTAKPVVVADCGQLC 172