BLASTX nr result
ID: Papaver27_contig00011997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00011997 (415 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB69304.1| hypothetical protein L484_002862 [Morus notabilis] 60 3e-07 emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] 58 1e-06 >gb|EXB69304.1| hypothetical protein L484_002862 [Morus notabilis] Length = 575 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/42 (66%), Positives = 35/42 (83%) Frame = +3 Query: 168 LVVELRMYIAINLKRYKKAKEVGKITMNVRIIAYYQLMQVCQ 293 LV +RM+IA+ +KRY+ KEVGKI M+V IIAYYQ+MQVCQ Sbjct: 295 LVGGVRMFIAVTIKRYRAVKEVGKIKMSVGIIAYYQVMQVCQ 336 >emb|CAN76054.1| hypothetical protein VITISV_036406 [Vitis vinifera] Length = 289 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +3 Query: 186 MYIAINLKRYKKAKEVGKITMNVRIIAYYQLMQVCQ 293 MYIA+ LKRY+ KEVGKI M+V IIA+YQLMQVCQ Sbjct: 1 MYIAVTLKRYRAVKEVGKIKMSVGIIAHYQLMQVCQ 36