BLASTX nr result
ID: Papaver27_contig00011412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00011412 (1571 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007012136.1| Nucleoporin Nup85-like isoform 1 [Theobroma ... 82 5e-13 ref|XP_007161496.1| hypothetical protein PHAVU_001G074000g [Phas... 80 3e-12 ref|XP_003550123.1| PREDICTED: nuclear pore complex protein Nup8... 80 3e-12 ref|XP_006476034.1| PREDICTED: nuclear pore complex protein Nup8... 77 2e-11 ref|XP_006450697.1| hypothetical protein CICLE_v10007610mg [Citr... 77 2e-11 ref|XP_006450696.1| hypothetical protein CICLE_v10007610mg [Citr... 77 2e-11 ref|XP_006450695.1| hypothetical protein CICLE_v10007610mg [Citr... 77 2e-11 ref|XP_006450694.1| hypothetical protein CICLE_v10007610mg [Citr... 77 2e-11 ref|XP_006853615.1| hypothetical protein AMTR_s00056p00051320 [A... 77 2e-11 dbj|BAF45348.1| nucleoporin [Lotus japonicus] 77 2e-11 ref|XP_004291177.1| PREDICTED: nuclear pore complex protein Nup8... 77 3e-11 ref|XP_002516506.1| conserved hypothetical protein [Ricinus comm... 76 4e-11 ref|XP_002283798.1| PREDICTED: nuclear pore complex protein Nup8... 76 5e-11 gb|EXB93382.1| hypothetical protein L484_010709 [Morus notabilis] 75 6e-11 ref|XP_006359748.1| PREDICTED: nuclear pore complex protein Nup8... 75 6e-11 ref|XP_006359747.1| PREDICTED: nuclear pore complex protein Nup8... 75 6e-11 ref|XP_006412412.1| hypothetical protein EUTSA_v10024536mg [Eutr... 75 6e-11 ref|XP_004245163.1| PREDICTED: nuclear pore complex protein Nup8... 75 6e-11 ref|XP_004498465.1| PREDICTED: nuclear pore complex protein Nup8... 75 8e-11 dbj|BAO49745.1| nuclear pore complex protein Nup75b [Nicotiana b... 74 1e-10 >ref|XP_007012136.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao] gi|590573493|ref|XP_007012137.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao] gi|508782499|gb|EOY29755.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao] gi|508782500|gb|EOY29756.1| Nucleoporin Nup85-like isoform 1 [Theobroma cacao] Length = 714 Score = 82.4 bits (202), Expect = 5e-13 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IELLTAGSN ++M LHEE N+GGISIEE+HRLVYA+VL+SH LTWQ Sbjct: 425 MVAHAIELLTAGSNHAEMLLHEERQNMGGISIEELHRLVYAQVLSSHPLTWQ 476 >ref|XP_007161496.1| hypothetical protein PHAVU_001G074000g [Phaseolus vulgaris] gi|561034960|gb|ESW33490.1| hypothetical protein PHAVU_001G074000g [Phaseolus vulgaris] Length = 527 Score = 79.7 bits (195), Expect = 3e-12 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IELLTAGS Q+++ LHEE +NLGGISI E+HRLVYA++L+SH LTWQ Sbjct: 238 LVAHAIELLTAGSEQAEVLLHEERYNLGGISIVELHRLVYAQILSSHALTWQ 289 >ref|XP_003550123.1| PREDICTED: nuclear pore complex protein Nup85-like [Glycine max] Length = 698 Score = 79.7 bits (195), Expect = 3e-12 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IELLTAGS Q+++ LHEE +NLGGISI E+HRLVYA++L+SH LTWQ Sbjct: 409 LVAHAIELLTAGSEQAEILLHEERYNLGGISIVELHRLVYAQILSSHALTWQ 460 >ref|XP_006476034.1| PREDICTED: nuclear pore complex protein Nup85-like [Citrus sinensis] Length = 711 Score = 77.4 bits (189), Expect = 2e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IE+LTAGS+Q+ LHEE NLGGIS+EE+HRLVYA+VL+SH LTWQ Sbjct: 421 MVTHAIEVLTAGSHQADTLLHEERDNLGGISMEELHRLVYAQVLSSHPLTWQ 472 >ref|XP_006450697.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] gi|557553923|gb|ESR63937.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] Length = 538 Score = 77.4 bits (189), Expect = 2e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IE+LTAGS+Q+ LHEE NLGGIS+EE+HRLVYA+VL+SH LTWQ Sbjct: 421 MVTHAIEVLTAGSHQADTLLHEERDNLGGISMEELHRLVYAQVLSSHPLTWQ 472 >ref|XP_006450696.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] gi|557553922|gb|ESR63936.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] Length = 711 Score = 77.4 bits (189), Expect = 2e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IE+LTAGS+Q+ LHEE NLGGIS+EE+HRLVYA+VL+SH LTWQ Sbjct: 421 MVTHAIEVLTAGSHQADTLLHEERDNLGGISMEELHRLVYAQVLSSHPLTWQ 472 >ref|XP_006450695.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] gi|557553921|gb|ESR63935.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] Length = 710 Score = 77.4 bits (189), Expect = 2e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IE+LTAGS+Q+ LHEE NLGGIS+EE+HRLVYA+VL+SH LTWQ Sbjct: 420 MVTHAIEVLTAGSHQADTLLHEERDNLGGISMEELHRLVYAQVLSSHPLTWQ 471 >ref|XP_006450694.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] gi|557553920|gb|ESR63934.1| hypothetical protein CICLE_v10007610mg [Citrus clementina] Length = 619 Score = 77.4 bits (189), Expect = 2e-11 Identities = 36/52 (69%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IE+LTAGS+Q+ LHEE NLGGIS+EE+HRLVYA+VL+SH LTWQ Sbjct: 421 MVTHAIEVLTAGSHQADTLLHEERDNLGGISMEELHRLVYAQVLSSHPLTWQ 472 >ref|XP_006853615.1| hypothetical protein AMTR_s00056p00051320 [Amborella trichopoda] gi|548857276|gb|ERN15082.1| hypothetical protein AMTR_s00056p00051320 [Amborella trichopoda] Length = 723 Score = 77.4 bits (189), Expect = 2e-11 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V H IELLTA S+Q+++ LHE+ +NLGGISIEE+HRLVYA+VL+SH LTWQ Sbjct: 426 MVVHAIELLTAKSHQAEVVLHEQRYNLGGISIEELHRLVYAQVLSSHALTWQ 477 >dbj|BAF45348.1| nucleoporin [Lotus japonicus] Length = 711 Score = 77.0 bits (188), Expect = 2e-11 Identities = 34/52 (65%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H +ELLTAGS Q+++ LH+E +NLGGISI E+HRL YA+VL+SH LTWQ Sbjct: 422 MVAHAVELLTAGSEQAEVLLHDEHYNLGGISIVELHRLAYAQVLSSHALTWQ 473 >ref|XP_004291177.1| PREDICTED: nuclear pore complex protein Nup85-like [Fragaria vesca subsp. vesca] Length = 712 Score = 76.6 bits (187), Expect = 3e-11 Identities = 35/52 (67%), Positives = 44/52 (84%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IELLT GS+ ++ LHEE +NLGGISI E+HRLVYA+VL+SH LTWQ Sbjct: 423 MVAHAIELLTTGSDHAESLLHEERYNLGGISIAELHRLVYAQVLSSHALTWQ 474 >ref|XP_002516506.1| conserved hypothetical protein [Ricinus communis] gi|223544326|gb|EEF45847.1| conserved hypothetical protein [Ricinus communis] Length = 725 Score = 76.3 bits (186), Expect = 4e-11 Identities = 36/52 (69%), Positives = 46/52 (88%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IELLTAGS Q++M L+EE NLGGISI E+H+LVYA+VL+SH+LTWQ Sbjct: 435 MVTHAIELLTAGSVQAEMLLNEERDNLGGISIGELHQLVYAQVLSSHILTWQ 486 >ref|XP_002283798.1| PREDICTED: nuclear pore complex protein Nup85 [Vitis vinifera] gi|296081842|emb|CBI20847.3| unnamed protein product [Vitis vinifera] Length = 715 Score = 75.9 bits (185), Expect = 5e-11 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H IELLTAGS+Q+++ L E NLGGISIEE+HRL+YA+VL+SH LTWQ Sbjct: 426 MVAHAIELLTAGSDQAEIILQEGRDNLGGISIEELHRLIYAQVLSSHALTWQ 477 >gb|EXB93382.1| hypothetical protein L484_010709 [Morus notabilis] Length = 692 Score = 75.5 bits (184), Expect = 6e-11 Identities = 35/52 (67%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H EL+TAGS+Q+++ LHEE NLG +SI E+HRLVYA+VLASHVLTWQ Sbjct: 403 MVAHATELMTAGSDQAEVLLHEERDNLGEMSIAELHRLVYAQVLASHVLTWQ 454 >ref|XP_006359748.1| PREDICTED: nuclear pore complex protein Nup85-like isoform X2 [Solanum tuberosum] Length = 717 Score = 75.5 bits (184), Expect = 6e-11 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +++H +ELLTAGS +++ LHEE LGG+SIEE+HRLVYA+VL+SH LTWQ Sbjct: 428 MMAHAVELLTAGSTHAEILLHEEHSKLGGVSIEELHRLVYAQVLSSHALTWQ 479 >ref|XP_006359747.1| PREDICTED: nuclear pore complex protein Nup85-like isoform X1 [Solanum tuberosum] Length = 719 Score = 75.5 bits (184), Expect = 6e-11 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +++H +ELLTAGS +++ LHEE LGG+SIEE+HRLVYA+VL+SH LTWQ Sbjct: 430 MMAHAVELLTAGSTHAEILLHEEHSKLGGVSIEELHRLVYAQVLSSHALTWQ 481 >ref|XP_006412412.1| hypothetical protein EUTSA_v10024536mg [Eutrema salsugineum] gi|557113582|gb|ESQ53865.1| hypothetical protein EUTSA_v10024536mg [Eutrema salsugineum] Length = 720 Score = 75.5 bits (184), Expect = 6e-11 Identities = 33/52 (63%), Positives = 45/52 (86%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +V+H +ELLTAGS++ + +HEE NLGGI++EE+HRLVYA+VL+SH LTWQ Sbjct: 430 MVAHAMELLTAGSDEGEALVHEEQRNLGGINMEELHRLVYAQVLSSHALTWQ 481 >ref|XP_004245163.1| PREDICTED: nuclear pore complex protein Nup85-like [Solanum lycopersicum] Length = 719 Score = 75.5 bits (184), Expect = 6e-11 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +++H +ELLTAGS +++ LHEE LGG+SIEE+HRLVYA+VL+SH LTWQ Sbjct: 430 MMAHAVELLTAGSTHAEILLHEEHSKLGGVSIEELHRLVYAQVLSSHALTWQ 481 >ref|XP_004498465.1| PREDICTED: nuclear pore complex protein Nup85-like [Cicer arietinum] Length = 709 Score = 75.1 bits (183), Expect = 8e-11 Identities = 32/52 (61%), Positives = 44/52 (84%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 +++H +ELLTAGS Q+++ LH+E NLGGISI E+HRL YA++L+SH LTWQ Sbjct: 420 MIAHAVELLTAGSEQAEILLHDERDNLGGISIVELHRLAYAQILSSHTLTWQ 471 >dbj|BAO49745.1| nuclear pore complex protein Nup75b [Nicotiana benthamiana] Length = 719 Score = 74.3 bits (181), Expect = 1e-10 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = +3 Query: 6 VVSHPIELLTAGSNQSKMFLHEECHNLGGISIEEIHRLVYARVLASHVLTWQ 161 ++SH +ELLTAGS +++ LHEE LGGISIEE+H+LVYA+VL+SH TWQ Sbjct: 430 MMSHAVELLTAGSTHAQILLHEEQSKLGGISIEELHKLVYAQVLSSHAFTWQ 481