BLASTX nr result
ID: Papaver27_contig00011305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00011305 (779 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627322.1| microtubule associated protein Type 2 [Medic... 45 2e-06 >ref|XP_003627322.1| microtubule associated protein Type 2 [Medicago truncatula] gi|355521344|gb|AET01798.1| microtubule associated protein Type 2 [Medicago truncatula] Length = 614 Score = 45.1 bits (105), Expect(2) = 2e-06 Identities = 22/35 (62%), Positives = 26/35 (74%) Frame = -3 Query: 777 RQWLEDRRFLQREMDPFYDEFAITERAAKYKA*LK 673 +QWLE+RRFLQ EM D+ AI ERAAK +A LK Sbjct: 323 KQWLEERRFLQGEMQQLRDKLAIVERAAKSEAQLK 357 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 4/98 (4%) Frame = -2 Query: 604 KFHLHLNILK-GLNSPSTTNSCTNLEGRGITTDVHASIPWHSRWESPNS---LPMNFCGR 437 K+ L L +L+ L S +S + EGR ++ S+ + P S LP Sbjct: 359 KYQLRLKVLEESLRGNSNGSSRSTPEGRSVSNSRRQSLGGADNFSKPTSNGFLPKRLPSF 418 Query: 436 EH*ITG*DLPCPQVLLLF*SMQGTSNSFDGGTRSLYRH 323 + P + + +GTS SFDGGTRSL R+ Sbjct: 419 QL------RSSPSSSSVLKNAKGTSKSFDGGTRSLERN 450