BLASTX nr result
ID: Papaver27_contig00011124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00011124 (1585 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002465815.1| hypothetical protein SORBIDRAFT_01g046340 [S... 59 6e-06 >ref|XP_002465815.1| hypothetical protein SORBIDRAFT_01g046340 [Sorghum bicolor] gi|241919669|gb|EER92813.1| hypothetical protein SORBIDRAFT_01g046340 [Sorghum bicolor] Length = 1028 Score = 58.9 bits (141), Expect = 6e-06 Identities = 34/140 (24%), Positives = 65/140 (46%), Gaps = 1/140 (0%) Frame = +1 Query: 475 DVNEVLKRVPWIIYEHLVVLKKYDNSIPLEEYEFSRQVFSVMFKDLALEHVHDGILDKLC 654 D+ VL PW++ +H +VLK YD + E F R V +L L ++ ++ Sbjct: 112 DLERVLSGTPWMVGKHAIVLKLYDEKLSASEIVFDRMDIWVRILNLPLGWMNQQRGARVM 171 Query: 655 QDIGRKITQEGSMGFTKRGRVVSAKIEVDLSQPLKRGNWL-LNAAKQKVWIRYHFEKQPR 831 IG + + G + ++ +++ +PL+RG L ++ +++ W +EK P Sbjct: 172 SLIGSVVKLDVDSDGKASGAFLRGRVSIEIDKPLRRGVLLRMSKSEEPKWFEAQYEKLP- 230 Query: 832 KICPDCFTIDHNQEMCEERA 891 C C + H++ C + A Sbjct: 231 YYCSSCGMLGHSEIGCSQPA 250