BLASTX nr result
ID: Papaver27_contig00010985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00010985 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prun... 76 4e-12 ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloro... 74 3e-11 ref|XP_006852460.1| hypothetical protein AMTR_s00021p00119000 [A... 73 4e-11 ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] ... 73 5e-11 sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, ... 72 6e-11 gb|AFK45087.1| unknown [Lotus japonicus] 72 8e-11 gb|AFK43276.1| unknown [Lotus japonicus] 72 8e-11 ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Popu... 71 2e-10 ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloro... 71 2e-10 emb|CBI30669.3| unnamed protein product [Vitis vinifera] 71 2e-10 ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloro... 71 2e-10 ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precu... 71 2e-10 emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] 71 2e-10 ref|XP_004970287.1| PREDICTED: 50S ribosomal protein L34, chloro... 68 1e-09 ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloro... 67 2e-09 ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citr... 67 2e-09 ref|NP_001238013.1| uncharacterized protein LOC100500433 [Glycin... 67 2e-09 ref|NP_001044556.2| Os01g0805000 [Oryza sativa Japonica Group] g... 67 3e-09 ref|NP_001149346.1| 50S ribosomal protein L34 [Zea mays] gi|1956... 67 3e-09 dbj|BAD68168.1| putative plastid ribosomal protein L34 precursor... 67 3e-09 >ref|XP_007212058.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] gi|462407923|gb|EMJ13257.1| hypothetical protein PRUPE_ppa011477mg [Prunus persica] Length = 209 Score = 76.3 bits (186), Expect = 4e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTTGGRA+LKRRRAKGR ILCTKTNPN+GKR Sbjct: 170 THGFRRRMRTTGGRAMLKRRRAKGRKILCTKTNPNSGKR 208 >ref|XP_004293930.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 150 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRA+LKRRRAKGR +LCTKTNPN+GKR Sbjct: 111 THGFRRRMRTTSGRAMLKRRRAKGRKVLCTKTNPNSGKR 149 >ref|XP_006852460.1| hypothetical protein AMTR_s00021p00119000 [Amborella trichopoda] gi|548856071|gb|ERN13927.1| hypothetical protein AMTR_s00021p00119000 [Amborella trichopoda] Length = 141 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTTGGRA+L RRRAKGR +LCTKTN NTGKR Sbjct: 102 THGFRRRMRTTGGRAVLNRRRAKGRKVLCTKTNSNTGKR 140 >ref|XP_007025416.1| 50S ribosomal protein L34 [Theobroma cacao] gi|508780782|gb|EOY28038.1| 50S ribosomal protein L34 [Theobroma cacao] Length = 158 Score = 72.8 bits (177), Expect = 5e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NPN+GKR Sbjct: 119 THGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGKR 157 >sp|P82244.1|RK34_SPIOL RecName: Full=50S ribosomal protein L34, chloroplastic; AltName: Full=CL34; Flags: Precursor gi|189096152|pdb|3BBO|4 Chain 4, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7578860|gb|AAF64157.1|AF238221_1 plastid ribosomal protein L34 precursor [Spinacia oleracea] Length = 152 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFRLRM TT GRA+LKRRRAKGR ILCTKTNP++GKR Sbjct: 111 THGFRLRMSTTSGRALLKRRRAKGRKILCTKTNPSSGKR 149 >gb|AFK45087.1| unknown [Lotus japonicus] Length = 146 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGK 267 THGFR RMRTTGGRAIL+RRRAKGR +LCTKT+PN+GK Sbjct: 109 THGFRRRMRTTGGRAILRRRRAKGRKVLCTKTHPNSGK 146 >gb|AFK43276.1| unknown [Lotus japonicus] Length = 146 Score = 72.0 bits (175), Expect = 8e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGK 267 THGFR RMRTTGGRAIL+RRRAKGR +LCTKT+PN+GK Sbjct: 109 THGFRRRMRTTGGRAILRRRRAKGRKVLCTKTHPNSGK 146 >ref|XP_002317427.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] gi|550327876|gb|EEE98039.2| hypothetical protein POPTR_0011s07530g [Populus trichocarpa] Length = 160 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGK 267 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NPN+GK Sbjct: 121 THGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 158 >ref|XP_004134668.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] gi|449479241|ref|XP_004155546.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Cucumis sativus] Length = 155 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NP++GKR Sbjct: 116 THGFRRRMRTTNGRAVLKRRRAKGRKVLCTKSNPSSGKR 154 >emb|CBI30669.3| unnamed protein product [Vitis vinifera] Length = 113 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NP++GKR Sbjct: 74 THGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKR 112 >ref|XP_002274637.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Vitis vinifera] Length = 148 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NP++GKR Sbjct: 109 THGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKR 147 >ref|XP_002522558.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] gi|223538249|gb|EEF39858.1| 50S ribosomal protein L34, chloroplast precursor, putative [Ricinus communis] Length = 161 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGK 267 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NPN+GK Sbjct: 122 THGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPNSGK 159 >emb|CAN60201.1| hypothetical protein VITISV_036402 [Vitis vinifera] Length = 148 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRA+LKRRRAKGR +LCTK+NP++GKR Sbjct: 109 THGFRRRMRTTSGRAVLKRRRAKGRKVLCTKSNPSSGKR 147 >ref|XP_004970287.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Setaria italica] Length = 167 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GR +LKRRRAKGR +LCTKTN N+GK+ Sbjct: 126 THGFRRRMRTTSGRKVLKRRRAKGRKVLCTKTNSNSGKK 164 >ref|XP_006467667.1| PREDICTED: 50S ribosomal protein L34, chloroplastic-like [Citrus sinensis] Length = 161 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRAILKRRRAKGR +LC K+ PN+GKR Sbjct: 122 THGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKR 160 >ref|XP_006449482.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|567914339|ref|XP_006449483.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552093|gb|ESR62722.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] gi|557552094|gb|ESR62723.1| hypothetical protein CICLE_v10017015mg [Citrus clementina] Length = 161 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GRAILKRRRAKGR +LC K+ PN+GKR Sbjct: 122 THGFRRRMRTTSGRAILKRRRAKGRWVLCPKSYPNSGKR 160 >ref|NP_001238013.1| uncharacterized protein LOC100500433 [Glycine max] gi|255630327|gb|ACU15520.1| unknown [Glycine max] Length = 146 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGK 267 THGFR RM T GGRA+L+RRRAKGR +LCTKT+PN+GK Sbjct: 109 THGFRKRMSTPGGRAVLRRRRAKGRRVLCTKTHPNSGK 146 >ref|NP_001044556.2| Os01g0805000 [Oryza sativa Japonica Group] gi|255673789|dbj|BAF06470.2| Os01g0805000, partial [Oryza sativa Japonica Group] Length = 95 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GR +LKRRRAKGR +LCTKTN TGK+ Sbjct: 54 THGFRRRMRTTAGRKVLKRRRAKGRRVLCTKTNSPTGKK 92 >ref|NP_001149346.1| 50S ribosomal protein L34 [Zea mays] gi|195626574|gb|ACG35117.1| 50S ribosomal protein L34 [Zea mays] gi|414880085|tpg|DAA57216.1| TPA: 50S ribosomal protein L34 [Zea mays] Length = 169 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GR +LKRRRAKGR +LCT+TN N+GK+ Sbjct: 128 THGFRRRMRTTSGRKVLKRRRAKGRKVLCTRTNSNSGKK 166 >dbj|BAD68168.1| putative plastid ribosomal protein L34 precursor [Oryza sativa Japonica Group] gi|125528074|gb|EAY76188.1| hypothetical protein OsI_04121 [Oryza sativa Indica Group] gi|125572355|gb|EAZ13870.1| hypothetical protein OsJ_03794 [Oryza sativa Japonica Group] Length = 167 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 380 THGFRLRMRTTGGRAILKRRRAKGRHILCTKTNPNTGKR 264 THGFR RMRTT GR +LKRRRAKGR +LCTKTN TGK+ Sbjct: 126 THGFRRRMRTTAGRKVLKRRRAKGRRVLCTKTNSPTGKK 164