BLASTX nr result
ID: Papaver27_contig00007411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00007411 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138013.1| PREDICTED: staphylococcal nuclease domain-co... 76 4e-12 gb|ADN33852.1| short-chain dehydrogenase/reductase [Cucumis melo... 76 4e-12 ref|XP_002273150.1| PREDICTED: staphylococcal nuclease domain-co... 76 4e-12 emb|CAN83456.1| hypothetical protein VITISV_034601 [Vitis vinifera] 76 4e-12 ref|XP_002318790.2| hypothetical protein POPTR_0012s11300g [Popu... 76 5e-12 ref|XP_002511064.1| ebna2 binding protein P100, putative [Ricinu... 76 5e-12 ref|XP_002322312.1| 110 kDa 4SNc-Tudor domain family protein [Po... 76 5e-12 ref|XP_007210402.1| hypothetical protein PRUPE_ppa000817mg [Prun... 75 7e-12 ref|XP_003532288.1| PREDICTED: staphylococcal nuclease domain-co... 75 7e-12 ref|XP_003526911.1| PREDICTED: staphylococcal nuclease domain-co... 75 7e-12 ref|XP_003523184.1| PREDICTED: staphylococcal nuclease domain-co... 75 7e-12 ref|XP_007137828.1| hypothetical protein PHAVU_009G159000g [Phas... 75 9e-12 gb|ACN40579.1| unknown [Picea sitchensis] 75 9e-12 ref|XP_003525164.1| PREDICTED: staphylococcal nuclease domain-co... 75 1e-11 ref|XP_002278217.1| PREDICTED: staphylococcal nuclease domain-co... 75 1e-11 ref|XP_006341451.1| PREDICTED: staphylococcal nuclease domain-co... 74 2e-11 ref|XP_007038186.1| TUDOR-SN protein 1 isoform 3 [Theobroma caca... 74 2e-11 ref|XP_007038185.1| TUDOR-SN protein 1 isoform 2 [Theobroma caca... 74 2e-11 ref|XP_007038184.1| TUDOR-SN protein 1 isoform 1 [Theobroma caca... 74 2e-11 ref|XP_004235862.1| PREDICTED: staphylococcal nuclease domain-co... 74 2e-11 >ref|XP_004138013.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Cucumis sativus] gi|449522262|ref|XP_004168146.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Cucumis sativus] Length = 988 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/47 (78%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 389 EVVSGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 435 >gb|ADN33852.1| short-chain dehydrogenase/reductase [Cucumis melo subsp. melo] Length = 988 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/47 (78%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 389 EVVSGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 435 >ref|XP_002273150.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Vitis vinifera] gi|296088151|emb|CBI35621.3| unnamed protein product [Vitis vinifera] Length = 1000 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/47 (78%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D+++PFG PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 391 EVVSGDCIIVADDSLPFGSPLAERRVNLSSIRCPKMGNPRRDERPAP 437 >emb|CAN83456.1| hypothetical protein VITISV_034601 [Vitis vinifera] Length = 983 Score = 76.3 bits (186), Expect = 4e-12 Identities = 37/47 (78%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D+++PFG PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 384 EVVSGDCIIVADDSLPFGSPLAERRVNLSSIRCPKMGNPRRDERPAP 430 >ref|XP_002318790.2| hypothetical protein POPTR_0012s11300g [Populus trichocarpa] gi|550326869|gb|EEE97010.2| hypothetical protein POPTR_0012s11300g [Populus trichocarpa] Length = 970 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/47 (76%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDC+IV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 386 EVVSGDCVIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_002511064.1| ebna2 binding protein P100, putative [Ricinus communis] gi|223550179|gb|EEF51666.1| ebna2 binding protein P100, putative [Ricinus communis] Length = 988 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDEPAPS 142 EVVSGDCIIV D++VPFG PLAERR+NLSSIR PK+GNP RDE S Sbjct: 385 EVVSGDCIIVADDSVPFGNPLAERRVNLSSIRCPKMGNPRRDEKPES 431 >ref|XP_002322312.1| 110 kDa 4SNc-Tudor domain family protein [Populus trichocarpa] gi|222869308|gb|EEF06439.1| 110 kDa 4SNc-Tudor domain family protein [Populus trichocarpa] Length = 984 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/47 (76%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDC+IV D++VP+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 386 EVVSGDCVIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_007210402.1| hypothetical protein PRUPE_ppa000817mg [Prunus persica] gi|462406137|gb|EMJ11601.1| hypothetical protein PRUPE_ppa000817mg [Prunus persica] Length = 994 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/47 (76%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDC+IV D++VPFG PLAERR+NLSSIR PK+GNP R+E PAP Sbjct: 391 EVVSGDCVIVADDSVPFGSPLAERRVNLSSIRCPKMGNPRREEKPAP 437 >ref|XP_003532288.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Glycine max] Length = 995 Score = 75.5 bits (184), Expect = 7e-12 Identities = 36/47 (76%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 392 EVVSGDCIIVADDSIPYGSPLAERRVNLSSIRCPKVGNPRRDEKPAP 438 >ref|XP_003526911.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Glycine max] Length = 990 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCI+V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 386 EVVSGDCIVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >ref|XP_003523184.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Glycine max] Length = 990 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCI+V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 387 EVVSGDCIVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 433 >ref|XP_007137828.1| hypothetical protein PHAVU_009G159000g [Phaseolus vulgaris] gi|561010915|gb|ESW09822.1| hypothetical protein PHAVU_009G159000g [Phaseolus vulgaris] Length = 992 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDC++V D+++P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 386 EVVSGDCVVVADDSIPYGSPLAERRVNLSSIRCPKMGNPRRDEKPAP 432 >gb|ACN40579.1| unknown [Picea sitchensis] Length = 988 Score = 75.1 bits (183), Expect = 9e-12 Identities = 35/47 (74%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCI+V D++ P+G PLAERR+NLSSIR+PK+GNP RDE PAP Sbjct: 384 EVVSGDCIVVADDSAPYGSPLAERRVNLSSIRAPKIGNPRRDEKPAP 430 >ref|XP_003525164.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Glycine max] Length = 991 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/47 (76%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D+ +P+G PLAERR+NLSSIR PK+GNP RDE PAP Sbjct: 388 EVVSGDCIIVADDLIPYGSPLAERRVNLSSIRCPKVGNPRRDEKPAP 434 >ref|XP_002278217.1| PREDICTED: staphylococcal nuclease domain-containing protein 1 [Vitis vinifera] gi|296082235|emb|CBI21240.3| unnamed protein product [Vitis vinifera] Length = 991 Score = 74.7 bits (182), Expect = 1e-11 Identities = 36/47 (76%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDCIIV D+ VP+G PLAERR+NLSSIR P++GNP RDE PAP Sbjct: 387 EVVSGDCIIVADDAVPYGSPLAERRVNLSSIRCPRMGNPRRDEKPAP 433 >ref|XP_006341451.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X1 [Solanum tuberosum] gi|565348928|ref|XP_006341452.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 978 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDC+++ D+++PFG P AERR+NLSSIRSPK+GNP RDE PAP Sbjct: 380 EVVSGDCLVIADDSLPFGDPSAERRVNLSSIRSPKIGNPRRDEKPAP 426 >ref|XP_007038186.1| TUDOR-SN protein 1 isoform 3 [Theobroma cacao] gi|590670901|ref|XP_007038187.1| TUDOR-SN protein 1 isoform 3 [Theobroma cacao] gi|508775431|gb|EOY22687.1| TUDOR-SN protein 1 isoform 3 [Theobroma cacao] gi|508775432|gb|EOY22688.1| TUDOR-SN protein 1 isoform 3 [Theobroma cacao] Length = 721 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE 130 EVVSGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE Sbjct: 388 EVVSGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDE 430 >ref|XP_007038185.1| TUDOR-SN protein 1 isoform 2 [Theobroma cacao] gi|508775430|gb|EOY22686.1| TUDOR-SN protein 1 isoform 2 [Theobroma cacao] Length = 722 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE 130 EVVSGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE Sbjct: 388 EVVSGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDE 430 >ref|XP_007038184.1| TUDOR-SN protein 1 isoform 1 [Theobroma cacao] gi|508775429|gb|EOY22685.1| TUDOR-SN protein 1 isoform 1 [Theobroma cacao] Length = 995 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE 130 EVVSGDCIIV D++VP+G PLAERR+NLSSIR PK+GNP RDE Sbjct: 388 EVVSGDCIIVADDSVPYGSPLAERRVNLSSIRCPKMGNPRRDE 430 >ref|XP_004235862.1| PREDICTED: staphylococcal nuclease domain-containing protein 1-like [Solanum lycopersicum] Length = 978 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/47 (72%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 2 EVVSGDCIIVDDNTVPFGRPLAERRINLSSIRSPKLGNPCRDE-PAP 139 EVVSGDC+++ D+++PFG P AERR+NLSSIRSPK+GNP RDE PAP Sbjct: 380 EVVSGDCLVIADDSLPFGDPSAERRVNLSSIRSPKMGNPRRDEKPAP 426