BLASTX nr result
ID: Papaver27_contig00007268
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00007268 (671 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007153687.1| hypothetical protein PHAVU_003G056400g [Phas... 80 6e-13 ref|XP_006357220.1| PREDICTED: paired amphipathic helix protein ... 79 2e-12 ref|XP_006357219.1| PREDICTED: paired amphipathic helix protein ... 79 2e-12 ref|XP_006357218.1| PREDICTED: paired amphipathic helix protein ... 79 2e-12 ref|XP_004239365.1| PREDICTED: paired amphipathic helix protein ... 79 2e-12 ref|XP_006574578.1| PREDICTED: paired amphipathic helix protein ... 78 3e-12 ref|XP_006574577.1| PREDICTED: paired amphipathic helix protein ... 78 3e-12 ref|XP_006573076.1| PREDICTED: paired amphipathic helix protein ... 78 3e-12 ref|XP_006573075.1| PREDICTED: paired amphipathic helix protein ... 78 3e-12 ref|XP_007157533.1| hypothetical protein PHAVU_002G077800g [Phas... 78 3e-12 ref|XP_007157532.1| hypothetical protein PHAVU_002G077800g [Phas... 78 3e-12 ref|XP_006392221.1| hypothetical protein EUTSA_v10023225mg [Eutr... 78 3e-12 ref|XP_004489351.1| PREDICTED: paired amphipathic helix protein ... 78 3e-12 ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein ... 78 3e-12 emb|CBI32068.3| unnamed protein product [Vitis vinifera] 78 3e-12 ref|XP_002520196.1| conserved hypothetical protein [Ricinus comm... 78 3e-12 ref|XP_004517035.1| PREDICTED: paired amphipathic helix protein ... 77 4e-12 ref|XP_007044457.1| WRKY domain class transcription factor [Theo... 77 5e-12 ref|XP_006585983.1| PREDICTED: paired amphipathic helix protein ... 77 6e-12 ref|XP_006585979.1| PREDICTED: paired amphipathic helix protein ... 77 6e-12 >ref|XP_007153687.1| hypothetical protein PHAVU_003G056400g [Phaseolus vulgaris] gi|561027041|gb|ESW25681.1| hypothetical protein PHAVU_003G056400g [Phaseolus vulgaris] Length = 1413 Score = 80.1 bits (196), Expect = 6e-13 Identities = 42/67 (62%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKDMF D+++KYD+FLEVM DFKAQRIDTT VIAR + K + L Sbjct: 42 NDALAYLKAVKDMFQDKREKYDDFLEVMKDFKAQRIDTTGVIARVKELFKGHKDLILGFN 101 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 102 TFLPKGY 108 >ref|XP_006357220.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X3 [Solanum tuberosum] Length = 1365 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDAL+YLK VK++F DR+DKYDEFL+VM DFK+QRIDT+ VIAR + K TL Sbjct: 35 NDALSYLKSVKEIFQDRRDKYDEFLDVMKDFKSQRIDTSGVIARVKDLFKGHRTLILGFN 94 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 95 TFLPKGY 101 >ref|XP_006357219.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X2 [Solanum tuberosum] Length = 1391 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDAL+YLK VK++F DR+DKYDEFL+VM DFK+QRIDT+ VIAR + K TL Sbjct: 35 NDALSYLKSVKEIFQDRRDKYDEFLDVMKDFKSQRIDTSGVIARVKDLFKGHRTLILGFN 94 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 95 TFLPKGY 101 >ref|XP_006357218.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X1 [Solanum tuberosum] Length = 1392 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDAL+YLK VK++F DR+DKYDEFL+VM DFK+QRIDT+ VIAR + K TL Sbjct: 35 NDALSYLKSVKEIFQDRRDKYDEFLDVMKDFKSQRIDTSGVIARVKDLFKGHRTLILGFN 94 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 95 TFLPKGY 101 >ref|XP_004239365.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Solanum lycopersicum] Length = 1361 Score = 78.6 bits (192), Expect = 2e-12 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDAL+YLK VK++F DR+DKYDEFL+VM DFK+QRIDT+ VIAR + K TL Sbjct: 35 NDALSYLKSVKEIFQDRRDKYDEFLDVMKDFKSQRIDTSGVIARVKDLFKGHRTLILGFN 94 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 95 TFLPKGY 101 >ref|XP_006574578.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X2 [Glycine max] Length = 1406 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_006574577.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X1 [Glycine max] Length = 1430 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_006573076.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X2 [Glycine max] Length = 1406 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTVGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_006573075.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X1 [Glycine max] Length = 1430 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTVGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_007157533.1| hypothetical protein PHAVU_002G077800g [Phaseolus vulgaris] gi|561030948|gb|ESW29527.1| hypothetical protein PHAVU_002G077800g [Phaseolus vulgaris] Length = 1428 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_007157532.1| hypothetical protein PHAVU_002G077800g [Phaseolus vulgaris] gi|561030947|gb|ESW29526.1| hypothetical protein PHAVU_002G077800g [Phaseolus vulgaris] Length = 1404 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_006392221.1| hypothetical protein EUTSA_v10023225mg [Eutrema salsugineum] gi|557088727|gb|ESQ29507.1| hypothetical protein EUTSA_v10023225mg [Eutrema salsugineum] Length = 1179 Score = 77.8 bits (190), Expect = 3e-12 Identities = 40/67 (59%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDAL+YLK VKDMF D+K+KYD FLEVM DFKAQR+DT VIAR + K + L Sbjct: 45 NDALSYLKAVKDMFQDKKEKYDTFLEVMKDFKAQRVDTNGVIARVKELFKGYDDLLLGFN 104 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 105 TFLPKGY 111 >ref|XP_004489351.1| PREDICTED: paired amphipathic helix protein Sin3-like 2-like [Cicer arietinum] Length = 1407 Score = 77.8 bits (190), Expect = 3e-12 Identities = 40/67 (59%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDAL+YLK+VKDMF D+K+KYD FLEVM DFKAQR DT VIAR + K L + Sbjct: 65 NDALSYLKEVKDMFQDQKEKYDSFLEVMKDFKAQRTDTVGVIARVKELFKGHNNLIFGFN 124 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 125 TFLPKGY 131 >ref|XP_002267856.2| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Vitis vinifera] Length = 1421 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >emb|CBI32068.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 43 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGHRDLILGFN 102 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 103 TFLPKGY 109 >ref|XP_002520196.1| conserved hypothetical protein [Ricinus communis] gi|223540688|gb|EEF42251.1| conserved hypothetical protein [Ricinus communis] Length = 1452 Score = 77.8 bits (190), Expect = 3e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D++DKYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 67 NDALAYLKAVKDIFQDKRDKYDDFLEVMKDFKAQRIDTAGVIARVKDLFKGHRDLILGFN 126 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 127 TFLPKGY 133 >ref|XP_004517035.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like [Cicer arietinum] Length = 1407 Score = 77.4 bits (189), Expect = 4e-12 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D+KDKYD+FLEVM DFKAQRIDT VIAR + + L Sbjct: 44 NDALAYLKAVKDIFQDKKDKYDDFLEVMKDFKAQRIDTAGVIARVKELFEGHRDLILGFN 103 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 104 TFLPKGY 110 >ref|XP_007044457.1| WRKY domain class transcription factor [Theobroma cacao] gi|508708392|gb|EOY00289.1| WRKY domain class transcription factor [Theobroma cacao] Length = 1446 Score = 77.0 bits (188), Expect = 5e-12 Identities = 40/67 (59%), Positives = 47/67 (70%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 NDALAYLK VKD+F D+++KYD+FLEVM DFKAQRIDT VIAR + K L Sbjct: 45 NDALAYLKAVKDIFQDKREKYDDFLEVMKDFKAQRIDTAGVIARVKELFKGYRDLILGFN 104 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 105 TFLPKGY 111 >ref|XP_006585983.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X6 [Glycine max] Length = 1394 Score = 76.6 bits (187), Expect = 6e-12 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 +DALAYLK VKDMF D+++KYD+FLEVM DFKAQRIDT+ VIAR + K + L Sbjct: 42 DDALAYLKAVKDMFQDKREKYDDFLEVMKDFKAQRIDTSGVIARVKELFKGHKDLILGFN 101 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 102 TFLPKGY 108 >ref|XP_006585979.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X2 [Glycine max] gi|571473638|ref|XP_006585980.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X3 [Glycine max] gi|571473640|ref|XP_006585981.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X4 [Glycine max] gi|571473642|ref|XP_006585982.1| PREDICTED: paired amphipathic helix protein Sin3-like 4-like isoform X5 [Glycine max] Length = 1395 Score = 76.6 bits (187), Expect = 6e-12 Identities = 40/67 (59%), Positives = 49/67 (73%) Frame = -3 Query: 498 NDALAYLKDVKDMFLDRKDKYDEFLEVM*DFKAQRIDTTWVIARGRIFLKSIETLFWVSV 319 +DALAYLK VKDMF D+++KYD+FLEVM DFKAQRIDT+ VIAR + K + L Sbjct: 42 DDALAYLKAVKDMFQDKREKYDDFLEVMKDFKAQRIDTSGVIARVKELFKGHKDLILGFN 101 Query: 318 PFLPESY 298 FLP+ Y Sbjct: 102 TFLPKGY 108