BLASTX nr result
ID: Papaver27_contig00005238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00005238 (1449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK22673.1| unknown [Picea sitchensis] 63 4e-07 gb|EXB22444.1| hypothetical protein L484_002169 [Morus notabilis] 61 1e-06 ref|XP_006428377.1| hypothetical protein CICLE_v10012549mg [Citr... 60 2e-06 ref|XP_006846649.1| hypothetical protein AMTR_s00156p00090720 [A... 60 2e-06 ref|XP_002519494.1| acylphosphatase, putative [Ricinus communis]... 60 2e-06 ref|XP_002277067.2| PREDICTED: acylphosphatase-like [Vitis vinif... 60 3e-06 ref|XP_006288618.1| hypothetical protein CARUB_v10001921mg [Caps... 59 5e-06 ref|XP_006373886.1| hypothetical protein POPTR_0016s09610g [Popu... 58 9e-06 >gb|ABK22673.1| unknown [Picea sitchensis] Length = 100 Score = 62.8 bits (151), Expect = 4e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -1 Query: 126 AENANELGLKGWVRNRRDGLVEALFSGDPDSVNNNLTDNKK 4 AENA ELGLKGWVRNRRDG VEA+FSGDP V+N L K+ Sbjct: 31 AENAKELGLKGWVRNRRDGTVEAVFSGDPQVVDNMLERCKR 71 >gb|EXB22444.1| hypothetical protein L484_002169 [Morus notabilis] Length = 204 Score = 60.8 bits (146), Expect = 1e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 135 NTKAENANELGLKGWVRNRRDGLVEALFSGDPDSV 31 N +NANELGLKGWVRNRRDG VEALFSG+P+SV Sbjct: 132 NWTIDNANELGLKGWVRNRRDGSVEALFSGNPNSV 166 >ref|XP_006428377.1| hypothetical protein CICLE_v10012549mg [Citrus clementina] gi|568883308|ref|XP_006494416.1| PREDICTED: uncharacterized protein LOC102608702 [Citrus sinensis] gi|557530434|gb|ESR41617.1| hypothetical protein CICLE_v10012549mg [Citrus clementina] Length = 253 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 135 NTKAENANELGLKGWVRNRRDGLVEALFSGDPDSV 31 N ENA +LGLKGWVRNRRDG VEALFSG+PDSV Sbjct: 181 NWTIENATQLGLKGWVRNRRDGSVEALFSGNPDSV 215 >ref|XP_006846649.1| hypothetical protein AMTR_s00156p00090720 [Amborella trichopoda] gi|548849501|gb|ERN08324.1| hypothetical protein AMTR_s00156p00090720 [Amborella trichopoda] Length = 93 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 126 AENANELGLKGWVRNRRDGLVEALFSGDPDSV 31 AENA ELGLKGWVRNRRDG VEALFSG+P SV Sbjct: 24 AENAQELGLKGWVRNRRDGSVEALFSGEPSSV 55 >ref|XP_002519494.1| acylphosphatase, putative [Ricinus communis] gi|223541357|gb|EEF42908.1| acylphosphatase, putative [Ricinus communis] Length = 194 Score = 60.1 bits (144), Expect = 2e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 135 NTKAENANELGLKGWVRNRRDGLVEALFSGDPDSV 31 N ENAN+LGLKGWVRNRRDG VEALFSGD D V Sbjct: 122 NWTIENANQLGLKGWVRNRRDGSVEALFSGDSDKV 156 >ref|XP_002277067.2| PREDICTED: acylphosphatase-like [Vitis vinifera] gi|147797990|emb|CAN62952.1| hypothetical protein VITISV_040968 [Vitis vinifera] gi|297741642|emb|CBI32774.3| unnamed protein product [Vitis vinifera] Length = 105 Score = 59.7 bits (143), Expect = 3e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 135 NTKAENANELGLKGWVRNRRDGLVEALFSGDPDSV 31 N ENA +LGLKGWVRNRRDG VEALFSG PDSV Sbjct: 33 NWTIENATQLGLKGWVRNRRDGSVEALFSGTPDSV 67 >ref|XP_006288618.1| hypothetical protein CARUB_v10001921mg [Capsella rubella] gi|482557324|gb|EOA21516.1| hypothetical protein CARUB_v10001921mg [Capsella rubella] Length = 220 Score = 58.9 bits (141), Expect = 5e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 135 NTKAENANELGLKGWVRNRRDGLVEALFSGDPDSVN 28 N ENA +LGLKGWVRNRRDG VEALFSG P+SV+ Sbjct: 148 NWTVENAEQLGLKGWVRNRRDGSVEALFSGPPESVD 183 >ref|XP_006373886.1| hypothetical protein POPTR_0016s09610g [Populus trichocarpa] gi|550321173|gb|ERP51683.1| hypothetical protein POPTR_0016s09610g [Populus trichocarpa] Length = 215 Score = 58.2 bits (139), Expect = 9e-06 Identities = 27/35 (77%), Positives = 28/35 (80%) Frame = -1 Query: 135 NTKAENANELGLKGWVRNRRDGLVEALFSGDPDSV 31 N ENA +LGLKGWVRNRRDG VEALFSGD D V Sbjct: 143 NWTVENATQLGLKGWVRNRRDGSVEALFSGDSDKV 177