BLASTX nr result
ID: Papaver27_contig00005170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00005170 (463 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007052483.1| Tetratricopeptide repeat-like superfamily pr... 76 4e-12 ref|XP_007052484.1| Tetratricopeptide repeat-like superfamily pr... 75 7e-12 ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containi... 73 4e-11 emb|CBI24939.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_006492786.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 ref|XP_006442194.1| hypothetical protein CICLE_v10020011mg [Citr... 70 2e-10 ref|XP_006442193.1| hypothetical protein CICLE_v10020011mg [Citr... 70 2e-10 ref|XP_007142496.1| hypothetical protein PHAVU_008G285500g [Phas... 68 1e-09 ref|XP_007219329.1| hypothetical protein PRUPE_ppa019225mg, part... 68 2e-09 ref|XP_002517779.1| pentatricopeptide repeat-containing protein,... 67 2e-09 ref|XP_003544432.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 gb|EXB68332.1| hypothetical protein L484_004678 [Morus notabilis] 66 4e-09 ref|XP_004308684.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 gb|EXB68330.1| hypothetical protein L484_004676 [Morus notabilis] 65 1e-08 ref|XP_002877905.1| pentatricopeptide repeat-containing protein ... 65 1e-08 ref|XP_006344375.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006403718.1| hypothetical protein EUTSA_v10011131mg, part... 64 2e-08 sp|Q9SCP4.1|PP279_ARATH RecName: Full=Pentatricopeptide repeat-c... 63 5e-08 ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|NP_190885.5| pentatricopeptide repeat-containing protein [Ar... 62 1e-07 >ref|XP_007052483.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508704744|gb|EOX96640.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 549 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 1/73 (1%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALET-KNS 177 A+GQA +L KM E++L M E KC PD+ITF+TMIQAY++ GM+EAAQ LE K + T KNS Sbjct: 453 AYGQAGDLKKMGELFLMMEEKKCMPDNITFATMIQAYNTHGMIEAAQNLENKLISTNKNS 512 Query: 178 LVSLSRTRAQTRV 216 ++ R R+ Sbjct: 513 VLVKEMIRNHVRI 525 >ref|XP_007052484.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|590724496|ref|XP_007052485.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|590724499|ref|XP_007052486.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508704745|gb|EOX96641.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508704746|gb|EOX96642.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] gi|508704747|gb|EOX96643.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 492 Score = 75.5 bits (184), Expect = 7e-12 Identities = 39/73 (53%), Positives = 52/73 (71%), Gaps = 1/73 (1%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALET-KNS 177 A+GQA +L KM E++L M E KC PD+ITF+TMIQAY++ GM+EAAQ LE K + T KNS Sbjct: 420 AYGQAGDLKKMGELFLMMEEKKCMPDNITFATMIQAYNTHGMIEAAQNLENKLISTNKNS 479 Query: 178 LVSLSRTRAQTRV 216 ++ R R+ Sbjct: 480 VLVKEMIRNHVRM 492 >ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Vitis vinifera] Length = 538 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKN 174 A+GQA ++ +M E++L M E KC PD+ITF+TMIQAY++ GM+EAAQ LE+ + TKN Sbjct: 419 AYGQAGDVERMGELFLVMKERKCKPDNITFATMIQAYNAQGMIEAAQNLEVNMITTKN 476 >emb|CBI24939.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/58 (56%), Positives = 46/58 (79%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKN 174 A+GQA ++ +M E++L M E KC PD+ITF+TMIQAY++ GM+EAAQ LE+ + TKN Sbjct: 419 AYGQAGDVERMGELFLVMKERKCKPDNITFATMIQAYNAQGMIEAAQNLEVNMITTKN 476 >ref|XP_006492786.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Citrus sinensis] Length = 471 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/59 (55%), Positives = 43/59 (72%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNS 177 A+GQA ++ KM E++L M E C PD+ITF+ MIQAYH+LGM EAAQ LE K + K + Sbjct: 405 AYGQAGDVEKMGELFLAMKERHCVPDNITFAVMIQAYHALGMTEAAQNLENKMIAMKEN 463 >ref|XP_006442194.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] gi|557544456|gb|ESR55434.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] Length = 338 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNS 177 A+GQA ++ KM E++L M E C PD+ITF+TMIQAY++LGM EAAQ LE K + K + Sbjct: 272 AYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKEN 330 >ref|XP_006442193.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] gi|557544455|gb|ESR55433.1| hypothetical protein CICLE_v10020011mg [Citrus clementina] Length = 471 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNS 177 A+GQA ++ KM E++L M E C PD+ITF+TMIQAY++LGM EAAQ LE K + K + Sbjct: 405 AYGQAGDVEKMGELFLTMKERHCVPDNITFATMIQAYNALGMTEAAQNLENKMIAMKEN 463 >ref|XP_007142496.1| hypothetical protein PHAVU_008G285500g [Phaseolus vulgaris] gi|593564681|ref|XP_007142497.1| hypothetical protein PHAVU_008G285500g [Phaseolus vulgaris] gi|561015629|gb|ESW14490.1| hypothetical protein PHAVU_008G285500g [Phaseolus vulgaris] gi|561015630|gb|ESW14491.1| hypothetical protein PHAVU_008G285500g [Phaseolus vulgaris] Length = 433 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/60 (53%), Positives = 45/60 (75%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNSL 180 A+GQA +L KM E+++ M E KC PD+ITF++MI AY++ GM EAAQ+LE + KN+L Sbjct: 367 AYGQAGDLKKMCELFMAMRERKCEPDNITFASMILAYNTQGMTEAAQKLENMMISAKNNL 426 >ref|XP_007219329.1| hypothetical protein PRUPE_ppa019225mg, partial [Prunus persica] gi|462415791|gb|EMJ20528.1| hypothetical protein PRUPE_ppa019225mg, partial [Prunus persica] Length = 473 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/60 (51%), Positives = 47/60 (78%), Gaps = 1/60 (1%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKAL-ETKNS 177 A+G+A ++ K+ E++L M E KC PDHITF+TMIQAY++ GM EAA++L+ + + T+NS Sbjct: 414 AYGRAGDVRKVSELFLAMKEKKCLPDHITFATMIQAYNARGMTEAAEDLQKRMITNTENS 473 >ref|XP_002517779.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543051|gb|EEF44586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/59 (52%), Positives = 42/59 (71%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNS 177 A+GQA ++ KM E++L+M E +C PD++TF+TMIQAY GM EAAQ LE L K + Sbjct: 419 AYGQAGDVDKMAELFLEMRERECMPDNVTFATMIQAYRGQGMTEAAQALEKMMLAAKGN 477 >ref|XP_003544432.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Glycine max] Length = 481 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNSL 180 A+GQA L KM E++L M E KC PD+ITF+ MIQ+Y++ GM EA Q LE + K+SL Sbjct: 415 AYGQAGNLKKMGELFLAMRERKCEPDNITFACMIQSYNTQGMTEAVQNLENMMISAKSSL 474 >gb|EXB68332.1| hypothetical protein L484_004678 [Morus notabilis] Length = 488 Score = 66.2 bits (160), Expect = 4e-09 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALET 168 A+GQA ++ M +++ M E KC PD ITF+TMI AY++LGM+EAAQ+LE K + T Sbjct: 421 AYGQAGDVKSMRQLFSAMKERKCYPDSITFATMIHAYNALGMMEAAQDLESKMIAT 476 >ref|XP_004308684.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Fragaria vesca subsp. vesca] Length = 462 Score = 65.5 bits (158), Expect = 7e-09 Identities = 29/56 (51%), Positives = 43/56 (76%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALET 168 A+G+A +++KM E++L M E KC PDHITF+TMIQA +LGM AA++L+ + + T Sbjct: 399 AYGRAGDINKMGELFLTMEEKKCVPDHITFATMIQACKALGMTAAAEDLKKRMITT 454 >gb|EXB68330.1| hypothetical protein L484_004676 [Morus notabilis] Length = 445 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/58 (50%), Positives = 43/58 (74%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKN 174 A+G+A ++ M +++ M E KC PD ITF+TMI AY++LGM+EAAQ+LE K + T + Sbjct: 387 AYGEAGDVKSMRQLFSAMKERKCYPDGITFATMIHAYNALGMMEAAQDLESKMIATND 444 >ref|XP_002877905.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297323743|gb|EFH54164.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 439 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/60 (48%), Positives = 44/60 (73%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNSL 180 A+GQA +L+ M+E+Y++M E KC PD ITF+TMI+ Y + G+ +A QELE + + T +L Sbjct: 374 AYGQAGDLATMKELYIQMEERKCKPDKITFATMIKTYKAHGIFDAVQELEKQMISTGENL 433 >ref|XP_006344375.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Solanum tuberosum] Length = 482 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/54 (53%), Positives = 41/54 (75%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKAL 162 A+GQA ++ +M ++L+M KC PD+ITFSTMIQAY+S GM EAA +L+ K + Sbjct: 395 AYGQAGDIERMVALFLEMKVRKCKPDYITFSTMIQAYNSQGMTEAAMDLKTKII 448 >ref|XP_006403718.1| hypothetical protein EUTSA_v10011131mg, partial [Eutrema salsugineum] gi|557104837|gb|ESQ45171.1| hypothetical protein EUTSA_v10011131mg, partial [Eutrema salsugineum] Length = 495 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALET 168 A+GQA +L+ M+E+YL+M E KC PD ITF+TMI+ Y + G+ +A QELE + + T Sbjct: 440 AYGQAGDLATMKELYLQMEERKCKPDKITFATMIKTYAAHGIFDAVQELEKQMIST 495 >sp|Q9SCP4.1|PP279_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g53170 gi|6630737|emb|CAB64220.1| nodulin / glutamate-ammonia ligase-like protein [Arabidopsis thaliana] Length = 447 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/60 (46%), Positives = 44/60 (73%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKNSL 180 A+GQA +L+ M+E+Y++M E KC PD ITF+TMI+ Y + G+ +A QELE + + + +L Sbjct: 385 AYGQAGDLATMKELYIQMEERKCKPDKITFATMIKTYTAHGIFDAVQELEKQMISSGENL 444 >ref|XP_004135941.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] gi|449514880|ref|XP_004164505.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Cucumis sativus] Length = 477 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = +1 Query: 4 FGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALETKN 174 +GQA + KM E++L+M ENKC PD ITF+TMI+A + GM E AQ LE K + T + Sbjct: 419 YGQAGNVRKMGELFLEMKENKCVPDGITFATMIRALKAQGMTEDAQRLENKLIATND 475 >ref|NP_190885.5| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332645523|gb|AEE79044.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 499 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/56 (48%), Positives = 42/56 (75%) Frame = +1 Query: 1 AFGQARELSKMEEMYLKMIENKCTPDHITFSTMIQAYHSLGMVEAAQELEMKALET 168 A+GQA +L+ M+E+Y++M E KC PD ITF+TMI+ Y + G+ +A QELE + + + Sbjct: 435 AYGQAGDLATMKELYIQMEERKCKPDKITFATMIKTYTAHGIFDAVQELEKQMISS 490