BLASTX nr result
ID: Papaver27_contig00004467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00004467 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prun... 105 7e-21 ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana... 100 2e-19 gb|AAF26091.1|AC012393_17 low temperature and salt responsive pr... 100 2e-19 ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana... 100 2e-19 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 100 2e-19 ref|XP_002884539.1| low temperature and salt responsive protein ... 100 2e-19 gb|ABK23665.1| unknown [Picea sitchensis] 100 2e-19 ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutr... 100 3e-19 gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] ... 100 3e-19 gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 100 4e-19 gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulu... 99 5e-19 ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Caps... 99 6e-19 ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatu... 98 1e-18 ref|XP_003557909.1| PREDICTED: hydrophobic protein LTI6A-like [B... 98 1e-18 ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays] gi|1956... 97 2e-18 ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutr... 96 4e-18 ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobrom... 96 4e-18 gb|ACU14699.1| unknown [Glycine max] 96 4e-18 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 96 4e-18 ref|NP_001060390.1| Os07g0635900 [Oryza sativa Japonica Group] g... 96 5e-18 >ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] gi|462401825|gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 105 bits (262), Expect = 7e-21 Identities = 46/56 (82%), Positives = 53/56 (94%) Frame = +1 Query: 49 VNMSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 + M TATFVDII+AI+LPPLGVFL+FGCEAEFWICL+LT FGYLPGIIYAI++LTK Sbjct: 38 IRMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >ref|NP_187240.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] gi|15214252|sp|Q9ZNS6.1|RCI2B_ARATH RecName: Full=Hydrophobic protein RCI2B; AltName: Full=Low temperature and salt-responsive protein LTI6B gi|6671968|gb|AAF23227.1|AC013454_14 low temperature and salt responsive protein (LTI6B) [Arabidopsis thaliana] gi|13957673|gb|AAK50618.1|AF264749_1 hydrophobic protein RCI2B [Arabidopsis thaliana] gi|4039152|gb|AAC97511.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|4325219|gb|AAD17303.1| hydrophobic protein [Arabidopsis thaliana] gi|21536934|gb|AAM61275.1| hydrophobic protein RCI2B (Low temperature and salt responsive protein LTI6B) [Arabidopsis thaliana] gi|51970648|dbj|BAD44016.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|109134195|gb|ABG25095.1| At3g05890 [Arabidopsis thaliana] gi|110737346|dbj|BAF00618.1| low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] gi|332640791|gb|AEE74312.1| Hydrophobic protein RCI2B [Arabidopsis thaliana] Length = 54 Score = 100 bits (249), Expect = 2e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFV+IILAIILPPLGVFL+FGC+ EFWICL+LT FGYLPGI+YA++++TK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|AAF26091.1|AC012393_17 low temperature and salt responsive protein LTI6B [Arabidopsis thaliana] Length = 67 Score = 100 bits (249), Expect = 2e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFV+IILAIILPPLGVFL+FGC+ EFWICL+LT FGYLPGI+YA++++TK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|NP_187239.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] gi|15214251|sp|Q9ZNQ7.1|RCI2A_ARATH RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A gi|6714401|gb|AAF26090.1|AC012393_16 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|13957674|gb|AAK50619.1|AF264749_2 hydrophobic protein RCI2A [Arabidopsis thaliana] gi|4039153|gb|AAC97512.1| low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] gi|4325217|gb|AAD17302.1| hydrophobic protein [Arabidopsis thaliana] gi|14335130|gb|AAK59845.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|14532470|gb|AAK63963.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|18655345|gb|AAL76128.1| AT3g05880/F10A16_18 [Arabidopsis thaliana] gi|332640790|gb|AEE74311.1| Hydrophobic protein RCI2A [Arabidopsis thaliana] Length = 54 Score = 100 bits (249), Expect = 2e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFVDII+AI+LPPLGVFLRFGC EFWICLVLT GY+PGIIYAI+VLTK Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 100 bits (249), Expect = 2e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFV+IILAIILPPLGVFL+FGC+ EFWICL+LT FGYLPGI+YA++++TK Sbjct: 673 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 726 >ref|XP_002884539.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] gi|297330379|gb|EFH60798.1| low temperature and salt responsive protein LTI6B [Arabidopsis lyrata subsp. lyrata] Length = 67 Score = 100 bits (249), Expect = 2e-19 Identities = 43/54 (79%), Positives = 52/54 (96%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFV+IILAIILPPLGVFL+FGC+ EFWICL+LT FGYLPGI+YA++++TK Sbjct: 1 MSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >gb|ABK23665.1| unknown [Picea sitchensis] Length = 54 Score = 100 bits (249), Expect = 2e-19 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 M+TATF+DI+LAI+LPPLGVFLR+ C AEFWICLVLTFFG+LPGIIYAI+VLTK Sbjct: 1 MATATFIDILLAILLPPLGVFLRYECHAEFWICLVLTFFGWLPGIIYAIYVLTK 54 >ref|XP_006408016.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] gi|557109162|gb|ESQ49469.1| hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 100 bits (248), Expect = 3e-19 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 M TATF+DI+LAI+LPPLGVFLRFGC EFWICLVLT FGYLPGI+YA++VLTK Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYVLTK 54 >gb|AFK81273.1| rare cold-inducible protein 2A [Camelina sativa] gi|388893090|gb|AFK81275.1| rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 100 bits (248), Expect = 3e-19 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFVDII+A++LPPLGVFLRFGC EFWICLVLT GY+PGIIYAI+VLTK Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 99.8 bits (247), Expect = 4e-19 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 M TATF+DII+AI+LPPLGVFL+FGC AEFWICL+LT FGY+PGIIYAI+++TK Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLFGYIPGIIYAIYIITK 54 >gb|EYU19377.1| hypothetical protein MIMGU_mgv1a0175922mg [Mimulus guttatus] Length = 54 Score = 99.4 bits (246), Expect = 5e-19 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 M +ATFVDII+AI+LPPLGVFL+FGCE EFWICLVLT FGYLPGIIYAI+ +TK Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIYAITK 54 >ref|XP_006298933.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] gi|482567642|gb|EOA31831.1| hypothetical protein CARUB_v10015055mg [Capsella rubella] Length = 54 Score = 99.0 bits (245), Expect = 6e-19 Identities = 41/54 (75%), Positives = 52/54 (96%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 MSTATFV+I+LAI+LPPLGVFL+FGC+ EFWICL+LT FGYLPGI+YA++++TK Sbjct: 1 MSTATFVEILLAILLPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54 >ref|XP_003626131.1| Hydrophobic protein RCI2B [Medicago truncatula] gi|87241331|gb|ABD33189.1| Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] gi|355501146|gb|AES82349.1| Hydrophobic protein RCI2B [Medicago truncatula] Length = 54 Score = 98.2 bits (243), Expect = 1e-18 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 M TATFVDIIL+I+LPPLGVFL+FG E EFWICLVLT FGYLPGIIYAI+++TK Sbjct: 1 MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYIITK 54 >ref|XP_003557909.1| PREDICTED: hydrophobic protein LTI6A-like [Brachypodium distachyon] Length = 56 Score = 97.8 bits (242), Expect = 1e-18 Identities = 42/53 (79%), Positives = 51/53 (96%) Frame = +1 Query: 58 STATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 +TATF+D+ILAIILPPLGVFL++GCE EFWICLVL+FFGYLPGIIYA++V+ K Sbjct: 4 NTATFIDLILAIILPPLGVFLKYGCEIEFWICLVLSFFGYLPGIIYAVWVIVK 56 >ref|NP_001232820.1| hydrophobic protein LTI6A [Zea mays] gi|195618322|gb|ACG30991.1| hydrophobic protein LTI6A [Zea mays] Length = 56 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/52 (80%), Positives = 48/52 (92%) Frame = +1 Query: 61 TATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 TATF+DIILAIILPPLGVF +FGC EFWICL+LTFFGYLPGIIYA++ +TK Sbjct: 5 TATFIDIILAIILPPLGVFFKFGCGVEFWICLILTFFGYLPGIIYAVWAITK 56 >ref|XP_006408015.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] gi|557109161|gb|ESQ49468.1| hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +1 Query: 49 VNMSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 + M TATFV+IILAIILPPLGVFL+FGC+ EFWICL+LT GYLPGIIYA++ +TK Sbjct: 55 LKMGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYALYAITK 110 >ref|XP_007031274.1| Stress-induced hydrophobic peptide [Theobroma cacao] gi|508719879|gb|EOY11776.1| Stress-induced hydrophobic peptide [Theobroma cacao] Length = 58 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = +1 Query: 58 STATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 STAT VDI+LAIILPPLGVFL++GCE EFWICLVLT FGY+PGIIYA++ +TK Sbjct: 5 STATCVDILLAIILPPLGVFLKYGCEVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|ACU14699.1| unknown [Glycine max] Length = 57 Score = 96.3 bits (238), Expect = 4e-18 Identities = 40/53 (75%), Positives = 50/53 (94%) Frame = +1 Query: 58 STATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 STAT++DI+LAIILPPLGVFL++GC+ EFWICLVLT FGY+PGIIYA++ +TK Sbjct: 5 STATYIDILLAIILPPLGVFLKYGCKVEFWICLVLTLFGYIPGIIYAVYAITK 57 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 96.3 bits (238), Expect = 4e-18 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = +1 Query: 55 MSTATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 M TAT VDIILA+ILPPLGVFL+FGC+AEFWICL+LT GY+PGIIYA++V+TK Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >ref|NP_001060390.1| Os07g0635900 [Oryza sativa Japonica Group] gi|73620937|sp|Q8H5T6.1|LTI6A_ORYSJ RecName: Full=Hydrophobic protein LTI6A; AltName: Full=Low temperature-induced protein 6A gi|23237810|dbj|BAC16385.1| putative low temperature and salt responsive protein [Oryza sativa Japonica Group] gi|45602863|gb|AAS72305.1| drought-induced hydrophobic protein [Oryza sativa Japonica Group] gi|47717899|gb|AAT37941.1| low temperature-induced low molecular weight integral membrane protein LTI6a [Oryza sativa Japonica Group] gi|113611926|dbj|BAF22304.1| Os07g0635900 [Oryza sativa Japonica Group] gi|125559297|gb|EAZ04833.1| hypothetical protein OsI_27011 [Oryza sativa Indica Group] gi|125601220|gb|EAZ40796.1| hypothetical protein OsJ_25274 [Oryza sativa Japonica Group] gi|149391025|gb|ABR25530.1| hydrophobic protein lti6b [Oryza sativa Indica Group] gi|215768082|dbj|BAH00311.1| unnamed protein product [Oryza sativa Japonica Group] Length = 56 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +1 Query: 58 STATFVDIILAIILPPLGVFLRFGCEAEFWICLVLTFFGYLPGIIYAIFVLTK 216 STAT +DIILAIILPPLGVF +FGC EFWICL+LTFFGYLPGIIYA++V+TK Sbjct: 4 STATCIDIILAIILPPLGVFFKFGCGIEFWICLLLTFFGYLPGIIYAVWVITK 56