BLASTX nr result
ID: Papaver27_contig00001498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00001498 (461 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546288.2| PREDICTED: twinkle homolog protein, chloropl... 65 1e-08 ref|XP_003534794.2| PREDICTED: twinkle homolog protein, chloropl... 65 1e-08 ref|XP_006656366.1| PREDICTED: twinkle homolog protein, chloropl... 65 1e-08 ref|XP_007147436.1| hypothetical protein PHAVU_006G124400g [Phas... 64 2e-08 ref|XP_004966296.1| PREDICTED: twinkle homolog protein, chloropl... 64 2e-08 gb|EMT33643.1| hypothetical protein F775_00849 [Aegilops tauschii] 64 2e-08 ref|XP_002437433.1| hypothetical protein SORBIDRAFT_10g026990 [S... 64 2e-08 dbj|BAD46002.1| unknown protein [Oryza sativa Japonica Group] gi... 64 2e-08 gb|EEC81157.1| hypothetical protein OsI_24073 [Oryza sativa Indi... 64 2e-08 gb|AFW76042.1| hypothetical protein ZEAMMB73_832314 [Zea mays] 64 3e-08 ref|XP_004512933.1| PREDICTED: DNA primase/helicase-like [Cicer ... 61 1e-07 ref|XP_006468363.1| PREDICTED: twinkle homolog protein, chloropl... 60 3e-07 ref|XP_006448835.1| hypothetical protein CICLE_v10014667mg [Citr... 60 3e-07 ref|XP_006853301.1| hypothetical protein AMTR_s00032p00034370 [A... 60 3e-07 ref|XP_002284693.2| PREDICTED: uncharacterized protein LOC100247... 60 4e-07 emb|CBI18948.3| unnamed protein product [Vitis vinifera] 60 4e-07 ref|XP_004158064.1| PREDICTED: twinkle protein, mitochondrial-li... 59 9e-07 gb|EXB63612.1| hypothetical protein L484_026953 [Morus notabilis] 57 2e-06 ref|XP_006415437.1| hypothetical protein EUTSA_v10006950mg [Eutr... 57 3e-06 ref|XP_006415436.1| hypothetical protein EUTSA_v10006950mg [Eutr... 57 3e-06 >ref|XP_003546288.2| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Glycine max] Length = 698 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RVRWP+K D CKDANEVLM+LGP ALKE+IE AE YP Sbjct: 365 RVRWPRKSRSDNCKDANEVLMYLGPDALKEVIENAELYP 403 >ref|XP_003534794.2| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Glycine max] Length = 700 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RVRWP+K D CKDANEVLM+LGP ALKE+IE AE YP Sbjct: 367 RVRWPRKSRSDNCKDANEVLMYLGPDALKEVIENAELYP 405 >ref|XP_006656366.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Oryza brachyantha] Length = 579 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV WPKK D+CKDANEVLMFLGP ALK++I+ AE YP Sbjct: 233 RVNWPKKNETDICKDANEVLMFLGPQALKKVIDNAELYP 271 >ref|XP_007147436.1| hypothetical protein PHAVU_006G124400g [Phaseolus vulgaris] gi|561020659|gb|ESW19430.1| hypothetical protein PHAVU_006G124400g [Phaseolus vulgaris] Length = 697 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RVRWPKK D CKDANEVLM+LGP ALKE+I+ AE YP Sbjct: 365 RVRWPKKGRSDNCKDANEVLMYLGPDALKEVIDNAELYP 403 >ref|XP_004966296.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Setaria italica] Length = 629 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK D CKDANEVLMFLGP AL+++IE AE YP Sbjct: 254 RVKWPKKNETDTCKDANEVLMFLGPQALRKVIEDAELYP 292 >gb|EMT33643.1| hypothetical protein F775_00849 [Aegilops tauschii] Length = 634 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK + CKDANEVLMFLGP ALKE+IE AE YP Sbjct: 309 RVKWPKKNETEFCKDANEVLMFLGPRALKEVIEGAELYP 347 >ref|XP_002437433.1| hypothetical protein SORBIDRAFT_10g026990 [Sorghum bicolor] gi|241915656|gb|EER88800.1| hypothetical protein SORBIDRAFT_10g026990 [Sorghum bicolor] Length = 770 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK D CKDANEVLMFLGP AL+++IE AE YP Sbjct: 383 RVKWPKKNDTDTCKDANEVLMFLGPQALRKVIEDAELYP 421 >dbj|BAD46002.1| unknown protein [Oryza sativa Japonica Group] gi|52077236|dbj|BAD46279.1| unknown protein [Oryza sativa Japonica Group] gi|300116969|dbj|BAJ10651.1| hypothetical protein [Oryza sativa Japonica Group] Length = 695 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV WPKK ++CKDANEVLMFLGP AL+++IE AE YP Sbjct: 349 RVNWPKKNENEICKDANEVLMFLGPQALRKVIEDAELYP 387 >gb|EEC81157.1| hypothetical protein OsI_24073 [Oryza sativa Indica Group] gi|222636070|gb|EEE66202.1| hypothetical protein OsJ_22328 [Oryza sativa Japonica Group] Length = 698 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV WPKK ++CKDANEVLMFLGP AL+++IE AE YP Sbjct: 365 RVNWPKKNENEICKDANEVLMFLGPQALRKVIEDAELYP 403 >gb|AFW76042.1| hypothetical protein ZEAMMB73_832314 [Zea mays] Length = 736 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV WPKK D CKDANEVLMFLGP AL+++IE AE YP Sbjct: 377 RVNWPKKNDTDTCKDANEVLMFLGPQALRKVIEDAELYP 415 >ref|XP_004512933.1| PREDICTED: DNA primase/helicase-like [Cicer arietinum] Length = 697 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RVRWPKK D CKDANEVLM+LG +ALKE IE AE YP Sbjct: 370 RVRWPKKGKIDDCKDANEVLMYLGANALKEAIENAELYP 408 >ref|XP_006468363.1| PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Citrus sinensis] Length = 709 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RVRWPKK D KDANEVLM+LGP ALKE++E AE YP Sbjct: 385 RVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYP 423 >ref|XP_006448835.1| hypothetical protein CICLE_v10014667mg [Citrus clementina] gi|557551446|gb|ESR62075.1| hypothetical protein CICLE_v10014667mg [Citrus clementina] Length = 599 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RVRWPKK D KDANEVLM+LGP ALKE++E AE YP Sbjct: 275 RVRWPKKNDVDHFKDANEVLMYLGPGALKEVVENAELYP 313 >ref|XP_006853301.1| hypothetical protein AMTR_s00032p00034370 [Amborella trichopoda] gi|548856954|gb|ERN14768.1| hypothetical protein AMTR_s00032p00034370 [Amborella trichopoda] Length = 689 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV WPKK +VCKDANEVLM LGP AL+++IE AE YP Sbjct: 361 RVSWPKKNEIEVCKDANEVLMHLGPQALRDVIENAELYP 399 >ref|XP_002284693.2| PREDICTED: uncharacterized protein LOC100247126 [Vitis vinifera] Length = 928 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK D KDANEVLM+LGP ALKE+IE AE YP Sbjct: 166 RVKWPKKNEVDHFKDANEVLMYLGPDALKEVIENAELYP 204 >emb|CBI18948.3| unnamed protein product [Vitis vinifera] Length = 696 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK D KDANEVLM+LGP ALKE+IE AE YP Sbjct: 375 RVKWPKKNEVDHFKDANEVLMYLGPDALKEVIENAELYP 413 >ref|XP_004158064.1| PREDICTED: twinkle protein, mitochondrial-like [Cucumis sativus] Length = 679 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/39 (66%), Positives = 31/39 (79%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK D KDANEVLM+LGP ALKE+++ AE YP Sbjct: 345 RVKWPKKNEVDHFKDANEVLMYLGPEALKEVVDNAELYP 383 >gb|EXB63612.1| hypothetical protein L484_026953 [Morus notabilis] Length = 705 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK D KDANEVLM++GP LKE+IE AE YP Sbjct: 347 RVKWPKKNEVDHFKDANEVLMYMGPDVLKEVIENAELYP 385 >ref|XP_006415437.1| hypothetical protein EUTSA_v10006950mg [Eutrema salsugineum] gi|557093208|gb|ESQ33790.1| hypothetical protein EUTSA_v10006950mg [Eutrema salsugineum] Length = 708 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK + CKDANEVLM +GPH+L E I AE YP Sbjct: 370 RVKWPKKSDDEHCKDANEVLMSMGPHSLSEAIHNAEPYP 408 >ref|XP_006415436.1| hypothetical protein EUTSA_v10006950mg [Eutrema salsugineum] gi|557093207|gb|ESQ33789.1| hypothetical protein EUTSA_v10006950mg [Eutrema salsugineum] Length = 673 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 3 RVRWPKKISGDVCKDANEVLMFLGPHALKEMIEQAEFYP 119 RV+WPKK + CKDANEVLM +GPH+L E I AE YP Sbjct: 370 RVKWPKKSDDEHCKDANEVLMSMGPHSLSEAIHNAEPYP 408