BLASTX nr result
ID: Papaver27_contig00001192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00001192 (587 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23367.1| hypothetical protein MIMGU_mgv1a0062362mg, partia... 62 1e-07 ref|XP_004141619.1| PREDICTED: DNA primase small subunit-like [C... 59 1e-06 ref|XP_007209127.1| hypothetical protein PRUPE_ppa005529mg [Prun... 57 4e-06 ref|XP_002303474.2| hypothetical protein POPTR_0003s10380g [Popu... 56 6e-06 ref|XP_002515859.1| DNA primase, putative [Ricinus communis] gi|... 56 6e-06 ref|XP_007040500.1| DNA primase isoform 3 [Theobroma cacao] gi|5... 56 8e-06 ref|XP_007040499.1| DNA primase isoform 2 [Theobroma cacao] gi|5... 56 8e-06 ref|XP_007040498.1| DNA primase isoform 1 [Theobroma cacao] gi|5... 56 8e-06 >gb|EYU23367.1| hypothetical protein MIMGU_mgv1a0062362mg, partial [Mimulus guttatus] Length = 178 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 96 PAKRNAYSGENAFTPVEKELVFDIDMSDYDDV 1 PA RNAYSG N FTPVEKELVFDID+SDYDDV Sbjct: 118 PANRNAYSGANVFTPVEKELVFDIDISDYDDV 149 >ref|XP_004141619.1| PREDICTED: DNA primase small subunit-like [Cucumis sativus] gi|449517297|ref|XP_004165682.1| PREDICTED: DNA primase small subunit-like [Cucumis sativus] Length = 450 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 96 PAKRNAYSGENAFTPVEKELVFDIDMSDYDDV 1 PAKR+AY+ +N FTPVE+ELVFDIDM+DYDDV Sbjct: 116 PAKRHAYADDNVFTPVERELVFDIDMTDYDDV 147 >ref|XP_007209127.1| hypothetical protein PRUPE_ppa005529mg [Prunus persica] gi|462404862|gb|EMJ10326.1| hypothetical protein PRUPE_ppa005529mg [Prunus persica] Length = 456 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 96 PAKRNAY--SGENAFTPVEKELVFDIDMSDYDDV 1 P+KR+AY SG+N FTPVE+EL+FDIDMSDYDDV Sbjct: 116 PSKRHAYAQSGDNVFTPVERELIFDIDMSDYDDV 149 >ref|XP_002303474.2| hypothetical protein POPTR_0003s10380g [Populus trichocarpa] gi|550342901|gb|EEE78453.2| hypothetical protein POPTR_0003s10380g [Populus trichocarpa] Length = 450 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/34 (73%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 96 PAKRNAY--SGENAFTPVEKELVFDIDMSDYDDV 1 PAK+NAY SG+N FTPVE+EL+FDID++DYDDV Sbjct: 115 PAKKNAYAQSGDNVFTPVERELIFDIDITDYDDV 148 >ref|XP_002515859.1| DNA primase, putative [Ricinus communis] gi|223545014|gb|EEF46528.1| DNA primase, putative [Ricinus communis] Length = 515 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 96 PAKRNAYS--GENAFTPVEKELVFDIDMSDYDDV 1 PAKR+AYS G+N FTPVE+EL+FDIDMSDYD+V Sbjct: 108 PAKRHAYSQSGDNVFTPVERELIFDIDMSDYDNV 141 >ref|XP_007040500.1| DNA primase isoform 3 [Theobroma cacao] gi|508777745|gb|EOY25001.1| DNA primase isoform 3 [Theobroma cacao] Length = 348 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 96 PAKRNAY--SGENAFTPVEKELVFDIDMSDYDDV 1 PAKR+AY SG+N FTPVE+ELVFDID++DYDDV Sbjct: 114 PAKRHAYAQSGDNVFTPVERELVFDIDITDYDDV 147 >ref|XP_007040499.1| DNA primase isoform 2 [Theobroma cacao] gi|508777744|gb|EOY25000.1| DNA primase isoform 2 [Theobroma cacao] Length = 451 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 96 PAKRNAY--SGENAFTPVEKELVFDIDMSDYDDV 1 PAKR+AY SG+N FTPVE+ELVFDID++DYDDV Sbjct: 114 PAKRHAYAQSGDNVFTPVERELVFDIDITDYDDV 147 >ref|XP_007040498.1| DNA primase isoform 1 [Theobroma cacao] gi|508777743|gb|EOY24999.1| DNA primase isoform 1 [Theobroma cacao] Length = 452 Score = 55.8 bits (133), Expect = 8e-06 Identities = 26/34 (76%), Positives = 31/34 (91%), Gaps = 2/34 (5%) Frame = -3 Query: 96 PAKRNAY--SGENAFTPVEKELVFDIDMSDYDDV 1 PAKR+AY SG+N FTPVE+ELVFDID++DYDDV Sbjct: 114 PAKRHAYAQSGDNVFTPVERELVFDIDITDYDDV 147