BLASTX nr result
ID: Papaver27_contig00001125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00001125 (385 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138662.1| PREDICTED: histidine--tRNA ligase-like [Cucu... 56 5e-06 >ref|XP_004138662.1| PREDICTED: histidine--tRNA ligase-like [Cucumis sativus] Length = 879 Score = 56.2 bits (134), Expect = 5e-06 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 1/48 (2%) Frame = +1 Query: 238 PRFLTNIEARASLVVLLNKLII-TQHGIRSALPILITDALNGGPFALE 378 P FLT EARASLVVLLNKLII + GIRS +P+LIT+ LN P L+ Sbjct: 63 PDFLTREEARASLVVLLNKLIISSSSGIRSVIPVLITETLNSKPETLQ 110