BLASTX nr result
ID: Papaver27_contig00000950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00000950 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABG49414.1| chloroplast omega-3 fatty acid desaturase [Jatrop... 139 3e-31 gb|ABE72960.1| chloroplast omega-3 fatty acid desaturase [Jatrop... 139 3e-31 ref|XP_002312163.2| chloroplast omega-3 desaturase family protei... 139 4e-31 gb|AAF27933.1|AF222989_1 omega-3 fatty acid desaturase [Capsicum... 139 5e-31 ref|XP_002871171.1| hypothetical protein ARALYDRAFT_487353 [Arab... 139 5e-31 gb|ACS26171.1| chloroplast fatty acid desaturase 8 [Brassica napus] 139 5e-31 gb|EXB88400.1| Omega-3 fatty acid desaturase [Morus notabilis] 138 9e-31 ref|NP_196177.1| fatty acid desaturase 8 [Arabidopsis thaliana] ... 138 9e-31 ref|XP_006399017.1| hypothetical protein EUTSA_v10013625mg [Eutr... 138 9e-31 ref|XP_002315154.2| hypothetical protein POPTR_0010s19510g [Popu... 138 9e-31 gb|AAB72241.1| omega-3 fatty acid desaturase [Petroselinum crispum] 138 9e-31 ref|NP_001190230.1| fatty acid desaturase 8 [Arabidopsis thalian... 138 9e-31 gb|ACS26172.1| chloroplast fatty acid desaturase 8 [Brassica napus] 138 9e-31 gb|AAW78909.2| fatty acid desaturase [Brassica rapa subsp. pekin... 138 9e-31 gb|AAL32546.1| temperature-sensitive omega-3 fatty acid desatura... 138 9e-31 gb|AGC51776.1| fatty acid desaturase [Manihot esculenta] 137 1e-30 ref|XP_006287799.1| hypothetical protein CARUB_v10001010mg [Caps... 137 1e-30 emb|CBI22803.3| unnamed protein product [Vitis vinifera] 137 2e-30 ref|XP_002264350.1| PREDICTED: omega-3 fatty acid desaturase, ch... 137 2e-30 emb|CAN80104.1| hypothetical protein VITISV_040344 [Vitis vinifera] 137 2e-30 >gb|ABG49414.1| chloroplast omega-3 fatty acid desaturase [Jatropha curcas] Length = 455 Score = 139 bits (351), Expect = 3e-31 Identities = 65/89 (73%), Positives = 73/89 (82%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + I+GPI++L Y IPYWIFVMWLD+VTYLHH HE KL +RG+E SYL Sbjct: 295 AMAALLVGLNFILGPIQMLKLYGIPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLR 354 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT VD DYGWINNIHHDIGTHVIHHLF Sbjct: 355 GGLTTVDRDYGWINNIHHDIGTHVIHHLF 383 >gb|ABE72960.1| chloroplast omega-3 fatty acid desaturase [Jatropha curcas] Length = 455 Score = 139 bits (351), Expect = 3e-31 Identities = 65/89 (73%), Positives = 73/89 (82%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + I+GPI++L Y IPYWIFVMWLD+VTYLHH HE KL +RG+E SYL Sbjct: 295 AMAALLVGLNFILGPIQMLKLYGIPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLR 354 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT VD DYGWINNIHHDIGTHVIHHLF Sbjct: 355 GGLTTVDRDYGWINNIHHDIGTHVIHHLF 383 >ref|XP_002312163.2| chloroplast omega-3 desaturase family protein [Populus trichocarpa] gi|550332575|gb|EEE89530.2| chloroplast omega-3 desaturase family protein [Populus trichocarpa] Length = 451 Score = 139 bits (350), Expect = 4e-31 Identities = 63/89 (70%), Positives = 73/89 (82%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV S ++GP +VL Y IPYWIFVMWLD+VTYLHH H++KL +RG+E SYL Sbjct: 291 AMAALLVCLSFVMGPFQVLKLYGIPYWIFVMWLDLVTYLHHHGHDEKLPWYRGKEWSYLR 350 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 351 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 379 >gb|AAF27933.1|AF222989_1 omega-3 fatty acid desaturase [Capsicum annuum] Length = 438 Score = 139 bits (349), Expect = 5e-31 Identities = 64/89 (71%), Positives = 73/89 (82%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV S ++GPI++L YVIPYW FVMWLD+VTYLHH H+ KL +RGEE SYL Sbjct: 276 AMAAFLVGLSFVMGPIQLLKLYVIPYWGFVMWLDIVTYLHHHGHDDKLPWYRGEEWSYLR 335 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 336 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 364 >ref|XP_002871171.1| hypothetical protein ARALYDRAFT_487353 [Arabidopsis lyrata subsp. lyrata] gi|297317008|gb|EFH47430.1| hypothetical protein ARALYDRAFT_487353 [Arabidopsis lyrata subsp. lyrata] Length = 435 Score = 139 bits (349), Expect = 5e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 277 AMAALLVCLNFVIGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 336 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 337 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 365 >gb|ACS26171.1| chloroplast fatty acid desaturase 8 [Brassica napus] Length = 432 Score = 139 bits (349), Expect = 5e-31 Identities = 67/107 (62%), Positives = 78/107 (72%), Gaps = 3/107 (2%) Frame = -1 Query: 326 LYMPHRP---VLVMPFMRSMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHR 156 L++P V P +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH Sbjct: 256 LFLPEEKKDVVTSTPCWIAMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHH 315 Query: 155 CHEQKLRRHRGEECSYLSGGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 HE KL +RG+E SYL GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 316 GHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIHHDIGTHVIHHLF 362 >gb|EXB88400.1| Omega-3 fatty acid desaturase [Morus notabilis] Length = 442 Score = 138 bits (347), Expect = 9e-31 Identities = 61/89 (68%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +M A L S ++GPI++L YV+PYWIFVMWLD+VTYLHH HE KL +RG+E SYL Sbjct: 289 TMVALLGCLSFVMGPIQILKLYVVPYWIFVMWLDLVTYLHHHGHEDKLPWYRGKEWSYLR 348 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGW+NNIHHDIGTHVIHHLF Sbjct: 349 GGLTTLDRDYGWLNNIHHDIGTHVIHHLF 377 >ref|NP_196177.1| fatty acid desaturase 8 [Arabidopsis thaliana] gi|1345972|sp|P48622.1|FAD3D_ARATH RecName: Full=Temperature-sensitive omega-3 fatty acid desaturase, chloroplastic; Flags: Precursor gi|13605712|gb|AAK32849.1|AF361837_1 AT5g05580/MOP10_12 [Arabidopsis thaliana] gi|471093|dbj|BAA04504.1| plastid fatty acid desaturase [Arabidopsis thaliana] gi|497219|gb|AAB60302.1| chloroplast linoleate desaturase [Arabidopsis thaliana] gi|516045|gb|AAA65621.1| omega-3 fatty acid desaturase [Arabidopsis thaliana] gi|10178135|dbj|BAB11547.1| temperature-sensitive omega-3 fatty acid desaturase, chloroplast precursor [Arabidopsis thaliana] gi|18700268|gb|AAL77744.1| AT5g05580/MOP10_12 [Arabidopsis thaliana] gi|332003509|gb|AED90892.1| fatty acid desaturase 8 [Arabidopsis thaliana] Length = 435 Score = 138 bits (347), Expect = 9e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 277 AMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 336 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 337 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 365 >ref|XP_006399017.1| hypothetical protein EUTSA_v10013625mg [Eutrema salsugineum] gi|557100107|gb|ESQ40470.1| hypothetical protein EUTSA_v10013625mg [Eutrema salsugineum] Length = 428 Score = 138 bits (347), Expect = 9e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 274 AMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 333 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 334 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 362 >ref|XP_002315154.2| hypothetical protein POPTR_0010s19510g [Populus trichocarpa] gi|566191672|ref|XP_006378657.1| chloroplast omega-3 desaturase family protein [Populus trichocarpa] gi|550330163|gb|EEF01325.2| hypothetical protein POPTR_0010s19510g [Populus trichocarpa] gi|550330164|gb|ERP56454.1| chloroplast omega-3 desaturase family protein [Populus trichocarpa] Length = 451 Score = 138 bits (347), Expect = 9e-31 Identities = 61/89 (68%), Positives = 73/89 (82%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA + S ++GP+++L Y IPYWIFVMWLD+VTYLHH H++KL +RGEE SYL Sbjct: 291 AMAALVACLSFVMGPVQMLKLYGIPYWIFVMWLDLVTYLHHHGHDEKLPWYRGEEWSYLR 350 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 351 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 379 >gb|AAB72241.1| omega-3 fatty acid desaturase [Petroselinum crispum] Length = 438 Score = 138 bits (347), Expect = 9e-31 Identities = 61/89 (68%), Positives = 73/89 (82%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GP+++LM Y IPYWIFVMWLD VTYLHH H+ KL +RG+E SYL Sbjct: 280 AMAALLVGLNFVMGPVKMLMLYGIPYWIFVMWLDFVTYLHHHGHDDKLPWYRGKEWSYLR 339 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHV+HHLF Sbjct: 340 GGLTTLDRDYGWINNIHHDIGTHVVHHLF 368 >ref|NP_001190230.1| fatty acid desaturase 8 [Arabidopsis thaliana] gi|332003510|gb|AED90893.1| fatty acid desaturase 8 [Arabidopsis thaliana] Length = 382 Score = 138 bits (347), Expect = 9e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 277 AMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 336 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 337 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 365 >gb|ACS26172.1| chloroplast fatty acid desaturase 8 [Brassica napus] Length = 432 Score = 138 bits (347), Expect = 9e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 274 AMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 333 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 334 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 362 >gb|AAW78909.2| fatty acid desaturase [Brassica rapa subsp. pekinensis] Length = 432 Score = 138 bits (347), Expect = 9e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 274 AMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 333 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 334 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 362 >gb|AAL32546.1| temperature-sensitive omega-3 fatty acid desaturase, chloroplast precursor [Arabidopsis thaliana] gi|20259912|gb|AAM13303.1| temperature-sensitive omega-3 fatty acid desaturase, chloroplast precursor [Arabidopsis thaliana] Length = 435 Score = 138 bits (347), Expect = 9e-31 Identities = 63/89 (70%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 277 AMAALLVCLNFVMGPIQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 336 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 337 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 365 >gb|AGC51776.1| fatty acid desaturase [Manihot esculenta] Length = 453 Score = 137 bits (346), Expect = 1e-30 Identities = 62/89 (69%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GP+++L Y IPYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 293 AMAALLVCLNFVMGPVQMLKLYGIPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 352 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 353 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 381 >ref|XP_006287799.1| hypothetical protein CARUB_v10001010mg [Capsella rubella] gi|482556505|gb|EOA20697.1| hypothetical protein CARUB_v10001010mg [Capsella rubella] Length = 431 Score = 137 bits (346), Expect = 1e-30 Identities = 62/89 (69%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV + ++GPI++L Y +PYWIFVMWLD VTYLHH HE KL +RG+E SYL Sbjct: 277 AMAALLVCLNFVMGPIQMLKLYGVPYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLR 336 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 337 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 365 >emb|CBI22803.3| unnamed protein product [Vitis vinifera] Length = 439 Score = 137 bits (344), Expect = 2e-30 Identities = 62/89 (69%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV S ++GPI++L Y +PYWIFVMWLD VTYLHH H+ KL +RG+E SYL Sbjct: 279 AMAALLVGLSFVMGPIQMLKLYGVPYWIFVMWLDFVTYLHHHGHDDKLPWYRGKEWSYLR 338 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 339 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 367 >ref|XP_002264350.1| PREDICTED: omega-3 fatty acid desaturase, chloroplastic [Vitis vinifera] Length = 452 Score = 137 bits (344), Expect = 2e-30 Identities = 62/89 (69%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV S ++GPI++L Y +PYWIFVMWLD VTYLHH H+ KL +RG+E SYL Sbjct: 292 AMAALLVGLSFVMGPIQMLKLYGVPYWIFVMWLDFVTYLHHHGHDDKLPWYRGKEWSYLR 351 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 352 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 380 >emb|CAN80104.1| hypothetical protein VITISV_040344 [Vitis vinifera] Length = 452 Score = 137 bits (344), Expect = 2e-30 Identities = 62/89 (69%), Positives = 72/89 (80%) Frame = -1 Query: 281 SMAASLVVCSRIVGPIRVLMSYVIPYWIFVMWLDMVTYLHHRCHEQKLRRHRGEECSYLS 102 +MAA LV S ++GPI++L Y +PYWIFVMWLD VTYLHH H+ KL +RG+E SYL Sbjct: 292 AMAALLVGLSFVMGPIQMLKLYGVPYWIFVMWLDFVTYLHHHGHDDKLPWYRGKEWSYLR 351 Query: 101 GGLTKVDCDYGWINNIHHDIGTHVIHHLF 15 GGLT +D DYGWINNIHHDIGTHVIHHLF Sbjct: 352 GGLTTLDRDYGWINNIHHDIGTHVIHHLF 380