BLASTX nr result
ID: Papaver27_contig00000658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00000658 (619 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007013334.1| HCO3- transporter family [Theobroma cacao] g... 60 4e-07 ref|XP_007226316.1| hypothetical protein PRUPE_ppa021289mg, part... 60 4e-07 ref|XP_002324278.1| hypothetical protein POPTR_0018s01350g [Popu... 60 4e-07 ref|XP_004245187.1| PREDICTED: boron transporter 4-like [Solanum... 60 7e-07 gb|ABR18319.1| unknown [Picea sitchensis] 60 7e-07 gb|EXB94144.1| Boron transporter 4 [Morus notabilis] 59 9e-07 ref|XP_006601135.1| PREDICTED: probable boron transporter 6-like... 59 9e-07 ref|XP_006416903.1| hypothetical protein EUTSA_v10007002mg [Eutr... 59 9e-07 ref|XP_007013808.1| HCO3- transporter family [Theobroma cacao] g... 59 9e-07 ref|XP_006306092.1| hypothetical protein CARUB_v10011515mg [Caps... 59 9e-07 ref|NP_172999.1| boron transporter 4 [Arabidopsis thaliana] gi|7... 59 9e-07 ref|XP_003603439.1| Anion exchanger family protein [Medicago tru... 59 9e-07 ref|XP_002892869.1| anion exchange family protein [Arabidopsis l... 59 9e-07 ref|XP_002514365.1| Boron transporter, putative [Ricinus communi... 59 9e-07 ref|XP_002308645.1| hypothetical protein POPTR_0006s26590g [Popu... 59 9e-07 ref|XP_006390387.1| hypothetical protein EUTSA_v10018222mg [Eutr... 59 1e-06 ref|XP_007216756.1| hypothetical protein PRUPE_ppa024840mg, part... 59 1e-06 ref|XP_004138738.1| PREDICTED: probable boron transporter 6-like... 59 1e-06 ref|XP_002529372.1| Boron transporter, putative [Ricinus communi... 59 1e-06 gb|EYU21945.1| hypothetical protein MIMGU_mgv1a002503mg [Mimulus... 59 2e-06 >ref|XP_007013334.1| HCO3- transporter family [Theobroma cacao] gi|508783697|gb|EOY30953.1| HCO3- transporter family [Theobroma cacao] Length = 669 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGL+GL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLIGLPPSNGVLPQSPMHTKSLAVLKRQIIRK 378 >ref|XP_007226316.1| hypothetical protein PRUPE_ppa021289mg, partial [Prunus persica] gi|462423252|gb|EMJ27515.1| hypothetical protein PRUPE_ppa021289mg, partial [Prunus persica] Length = 647 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 378 >ref|XP_002324278.1| hypothetical protein POPTR_0018s01350g [Populus trichocarpa] gi|222865712|gb|EEF02843.1| hypothetical protein POPTR_0018s01350g [Populus trichocarpa] Length = 666 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >ref|XP_004245187.1| PREDICTED: boron transporter 4-like [Solanum lycopersicum] Length = 656 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLG+ P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGIPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >gb|ABR18319.1| unknown [Picea sitchensis] Length = 671 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 L+CGLLGL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 347 LLCGLLGLPPSNGVLPQSPMHTKSLAVLKRQMIRK 381 >gb|EXB94144.1| Boron transporter 4 [Morus notabilis] Length = 663 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VL+R ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRRLIRK 378 >ref|XP_006601135.1| PREDICTED: probable boron transporter 6-like [Glycine max] Length = 663 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICG+LGL P+NGV P+SPMHTKSLTVL++ ++RK Sbjct: 346 LICGILGLPPSNGVLPQSPMHTKSLTVLRKQLIRK 380 >ref|XP_006416903.1| hypothetical protein EUTSA_v10007002mg [Eutrema salsugineum] gi|557094674|gb|ESQ35256.1| hypothetical protein EUTSA_v10007002mg [Eutrema salsugineum] Length = 667 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLKR ++R+ Sbjct: 349 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRR 383 >ref|XP_007013808.1| HCO3- transporter family [Theobroma cacao] gi|508784171|gb|EOY31427.1| HCO3- transporter family [Theobroma cacao] Length = 666 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLK+ ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLKKQLIRK 378 >ref|XP_006306092.1| hypothetical protein CARUB_v10011515mg [Capsella rubella] gi|482574803|gb|EOA38990.1| hypothetical protein CARUB_v10011515mg [Capsella rubella] Length = 686 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLKR ++R+ Sbjct: 348 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRR 382 >ref|NP_172999.1| boron transporter 4 [Arabidopsis thaliana] gi|75215622|sp|Q9XI23.1|BOR4_ARATH RecName: Full=Boron transporter 4 gi|5103843|gb|AAD39673.1|AC007591_38 Is a member of the PF|00955 Anion exchanger family [Arabidopsis thaliana] gi|17978949|gb|AAL47440.1| At1g15460/T16N11_24 [Arabidopsis thaliana] gi|332191205|gb|AEE29326.1| boron transporter 4 [Arabidopsis thaliana] Length = 683 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLKR ++R+ Sbjct: 349 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRR 383 >ref|XP_003603439.1| Anion exchanger family protein [Medicago truncatula] gi|355492487|gb|AES73690.1| Anion exchanger family protein [Medicago truncatula] Length = 696 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VL+R ++RK Sbjct: 348 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRQLIRK 382 >ref|XP_002892869.1| anion exchange family protein [Arabidopsis lyrata subsp. lyrata] gi|297338711|gb|EFH69128.1| anion exchange family protein [Arabidopsis lyrata subsp. lyrata] Length = 683 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLKR ++R+ Sbjct: 349 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRR 383 >ref|XP_002514365.1| Boron transporter, putative [Ricinus communis] gi|223546821|gb|EEF48319.1| Boron transporter, putative [Ricinus communis] Length = 658 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLK+ ++RK Sbjct: 341 LICGLLGLPPSNGVLPQSPMHTKSLAVLKKQLIRK 375 >ref|XP_002308645.1| hypothetical protein POPTR_0006s26590g [Populus trichocarpa] gi|222854621|gb|EEE92168.1| hypothetical protein POPTR_0006s26590g [Populus trichocarpa] Length = 666 Score = 59.3 bits (142), Expect = 9e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VL+R ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRQLIRK 378 >ref|XP_006390387.1| hypothetical protein EUTSA_v10018222mg [Eutrema salsugineum] gi|557086821|gb|ESQ27673.1| hypothetical protein EUTSA_v10018222mg [Eutrema salsugineum] Length = 684 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 L+CGLLGL P+NGV P+SPMHTKSL VLKR ++R+ Sbjct: 350 LVCGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRR 384 >ref|XP_007216756.1| hypothetical protein PRUPE_ppa024840mg, partial [Prunus persica] gi|462412906|gb|EMJ17955.1| hypothetical protein PRUPE_ppa024840mg, partial [Prunus persica] Length = 655 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 L+CGL+GL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LLCGLIGLPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >ref|XP_004138738.1| PREDICTED: probable boron transporter 6-like [Cucumis sativus] gi|449514986|ref|XP_004164531.1| PREDICTED: probable boron transporter 6-like [Cucumis sativus] Length = 659 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL VLKR + RK Sbjct: 341 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLFRK 375 >ref|XP_002529372.1| Boron transporter, putative [Ricinus communis] gi|223531192|gb|EEF33039.1| Boron transporter, putative [Ricinus communis] Length = 652 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 LICGLLGL P+NGV P+SPMHTKSL+VL R ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLSVLNRQLIRK 378 >gb|EYU21945.1| hypothetical protein MIMGU_mgv1a002503mg [Mimulus guttatus] Length = 666 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 615 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 511 L+CGLLGL P+NGV P+SPMHT+SL VLKR ++RK Sbjct: 345 LLCGLLGLPPSNGVLPQSPMHTRSLAVLKRQIMRK 379