BLASTX nr result
ID: Papaver25_contig00026157
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00026157 (694 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007031352.1| Family of Uncharacterized protein function, ... 59 1e-06 ref|XP_002516040.1| conserved hypothetical protein [Ricinus comm... 57 6e-06 >ref|XP_007031352.1| Family of Uncharacterized protein function, putative [Theobroma cacao] gi|508710381|gb|EOY02278.1| Family of Uncharacterized protein function, putative [Theobroma cacao] Length = 333 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = +1 Query: 7 LFYGTWFVQTGFKFYTDSTVHGYGLHETSRGTITVKCKLH 126 + GTWFVQ GF FYT+ VHG LHE SRG T+KCK H Sbjct: 193 ILQGTWFVQMGFSFYTNLIVHGCSLHEKSRGNYTIKCKGH 232 >ref|XP_002516040.1| conserved hypothetical protein [Ricinus communis] gi|223544945|gb|EEF46460.1| conserved hypothetical protein [Ricinus communis] Length = 318 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/40 (60%), Positives = 27/40 (67%) Frame = +1 Query: 7 LFYGTWFVQTGFKFYTDSTVHGYGLHETSRGTITVKCKLH 126 + GTWFVQ G FYT+ VHG LHE SRG T+KCK H Sbjct: 184 ILQGTWFVQMGISFYTNMIVHGCSLHERSRGDYTIKCKGH 223