BLASTX nr result
ID: Papaver25_contig00026132
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver25_contig00026132 (802 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB37027.1| hypothetical protein L484_020813 [Morus notabilis] 57 6e-06 >gb|EXB37027.1| hypothetical protein L484_020813 [Morus notabilis] Length = 93 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/36 (63%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +2 Query: 506 QYCLCSPTQHPGSFRCKHHQNGYQWGTAN-ARNRLQ 610 +YCLCSPTQHPGSFRC+ H Y WGT RNR++ Sbjct: 58 RYCLCSPTQHPGSFRCRQHLGEYAWGTGRVVRNRVE 93