BLASTX nr result
ID: Papaver23_contig00034345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034345 (649 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26657.3| unnamed protein product [Vitis vinifera] 56 5e-06 ref|XP_002279440.1| PREDICTED: mutS protein homolog 5-like [Viti... 56 5e-06 >emb|CBI26657.3| unnamed protein product [Vitis vinifera] Length = 793 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 599 QSEKIKFYTMSVLRPDNSSCTDVEDIVFLYRFM 501 +SEKI+FYTMSVLRPDN +CTD+EDIVFLYR + Sbjct: 681 KSEKIRFYTMSVLRPDN-NCTDIEDIVFLYRLV 712 >ref|XP_002279440.1| PREDICTED: mutS protein homolog 5-like [Vitis vinifera] Length = 807 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 599 QSEKIKFYTMSVLRPDNSSCTDVEDIVFLYRFM 501 +SEKI+FYTMSVLRPDN +CTD+EDIVFLYR + Sbjct: 695 KSEKIRFYTMSVLRPDN-NCTDIEDIVFLYRLV 726