BLASTX nr result
ID: Papaver23_contig00034063
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00034063 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520104.1| PREDICTED: heparanase-like protein 2-like [G... 72 6e-13 ref|XP_002315010.1| predicted protein [Populus trichocarpa] gi|2... 76 6e-13 ref|XP_002512115.1| conserved hypothetical protein [Ricinus comm... 74 8e-13 ref|XP_003520102.1| PREDICTED: heparanase-like protein 2-like [G... 71 5e-12 ref|XP_002512114.1| Heparanase precursor, putative [Ricinus comm... 71 8e-12 >ref|XP_003520104.1| PREDICTED: heparanase-like protein 2-like [Glycine max] Length = 525 Score = 72.4 bits (176), Expect(2) = 6e-13 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -2 Query: 236 NGFSSHQYLGQLGMTGTFNHKVFCRQTLIGGN*LWSSKYHNTMVLNPDYCWALLWHRLMG 57 NGF YL QLGMT TFNHKV+CRQ L+GGN + T + NPDY ALLWHRLMG Sbjct: 343 NGF---WYLDQLGMTSTFNHKVYCRQALVGGN--YGLLDTTTFIPNPDYYGALLWHRLMG 397 Score = 26.2 bits (56), Expect(2) = 6e-13 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -1 Query: 51 SMTRDGSPYLLAYSQCS 1 S++ +GSPYL AY CS Sbjct: 402 SVSHEGSPYLRAYVHCS 418 >ref|XP_002315010.1| predicted protein [Populus trichocarpa] gi|222864050|gb|EEF01181.1| predicted protein [Populus trichocarpa] Length = 518 Score = 75.9 bits (185), Expect(2) = 6e-13 Identities = 39/62 (62%), Positives = 44/62 (70%) Frame = -2 Query: 236 NGFSSHQYLGQLGMTGTFNHKVFCRQTLIGGN*LWSSKYHNTMVLNPDYCWALLWHRLMG 57 NGF YL QLGMT TFNHKV+CRQTLIGGN + + + NPDY ALLWHRLMG Sbjct: 332 NGF---WYLDQLGMTATFNHKVYCRQTLIGGN--YGLLNTTSFIPNPDYYGALLWHRLMG 386 Query: 56 KS 51 K+ Sbjct: 387 KT 388 Score = 22.7 bits (47), Expect(2) = 6e-13 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 36 GSPYLLAYSQCS 1 GSPYL Y+ CS Sbjct: 396 GSPYLRTYTHCS 407 >ref|XP_002512115.1| conserved hypothetical protein [Ricinus communis] gi|223549295|gb|EEF50784.1| conserved hypothetical protein [Ricinus communis] Length = 206 Score = 74.3 bits (181), Expect(2) = 8e-13 Identities = 37/55 (67%), Positives = 40/55 (72%) Frame = -2 Query: 215 YLGQLGMTGTFNHKVFCRQTLIGGN*LWSSKYHNTMVLNPDYCWALLWHRLMGKS 51 YL QLGMT TFNHKVFCRQTLIGGN + T + NPD ALLWHRLMGK+ Sbjct: 129 YLDQLGMTSTFNHKVFCRQTLIGGN--YGLLNTTTFIPNPDNYGALLWHRLMGKN 181 Score = 23.9 bits (50), Expect(2) = 8e-13 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -1 Query: 36 GSPYLLAYSQC 4 GSPYL AYS C Sbjct: 189 GSPYLRAYSHC 199 >ref|XP_003520102.1| PREDICTED: heparanase-like protein 2-like [Glycine max] Length = 518 Score = 71.2 bits (173), Expect(2) = 5e-12 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = -2 Query: 236 NGFSSHQYLGQLGMTGTFNHKVFCRQTLIGGN*LWSSKYHNTMVLNPDYCWALLWHRLMG 57 NGF YL QLGMT T NHKV+CRQ+LIGGN + T + NPDY ALLWHRLMG Sbjct: 332 NGF---WYLDQLGMTSTLNHKVYCRQSLIGGN--YGLLNTTTFIPNPDYYGALLWHRLMG 386 Score = 24.3 bits (51), Expect(2) = 5e-12 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 51 SMTRDGSPYLLAYSQCS 1 S++ +GSP+L Y+ CS Sbjct: 391 SVSHEGSPFLRTYAHCS 407 >ref|XP_002512114.1| Heparanase precursor, putative [Ricinus communis] gi|223549294|gb|EEF50783.1| Heparanase precursor, putative [Ricinus communis] Length = 596 Score = 70.9 bits (172), Expect(2) = 8e-12 Identities = 36/61 (59%), Positives = 41/61 (67%) Frame = -2 Query: 236 NGFSSHQYLGQLGMTGTFNHKVFCRQTLIGGN*LWSSKYHNTMVLNPDYCWALLWHRLMG 57 NGF YL QLGMT T+NHKV+CRQ IGGN + + + NPDY ALLWHRLMG Sbjct: 343 NGF---WYLDQLGMTSTYNHKVYCRQAFIGGN--YGLLNTTSFIPNPDYYGALLWHRLMG 397 Query: 56 K 54 K Sbjct: 398 K 398 Score = 23.9 bits (50), Expect(2) = 8e-12 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 45 TRDGSPYLLAYSQCS 1 + + SPYL AYS CS Sbjct: 404 SHNASPYLRAYSHCS 418