BLASTX nr result
ID: Papaver23_contig00033021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00033021 (532 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004172163.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 ref|XP_004137089.1| PREDICTED: pentatricopeptide repeat-containi... 55 6e-06 ref|XP_002518652.1| pentatricopeptide repeat-containing protein,... 55 6e-06 >ref|XP_004172163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Cucumis sativus] Length = 831 Score = 55.1 bits (131), Expect = 6e-06 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 3/97 (3%) Frame = +2 Query: 251 PNPTTTSAS-PFTPLLQEILLQNPNSTKTXXXXXXXXXXXXXXXXXXXXXXXTRLGKSGD 427 P P +SAS P PLLQ++L S+ T TR+G+S D Sbjct: 43 PTPHLSSASSPLAPLLQDLLPHQHPSSSTQPHLPKPTFRTR-----------TRIGRSHD 91 Query: 428 RNRGKPWASEQLSVKGQQILETLISTE--SNDVTEIL 532 NRGKPW+ +LS +GQ+IL++L++ E S+ + EIL Sbjct: 92 PNRGKPWSHHRLSTQGQRILDSLLNPEFDSSSLDEIL 128 >ref|XP_004137089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Cucumis sativus] Length = 831 Score = 55.1 bits (131), Expect = 6e-06 Identities = 36/97 (37%), Positives = 52/97 (53%), Gaps = 3/97 (3%) Frame = +2 Query: 251 PNPTTTSAS-PFTPLLQEILLQNPNSTKTXXXXXXXXXXXXXXXXXXXXXXXTRLGKSGD 427 P P +SAS P PLLQ++L S+ T TR+G+S D Sbjct: 43 PTPHLSSASSPLAPLLQDLLPHQHPSSSTQPHLPKPTFRTR-----------TRIGRSHD 91 Query: 428 RNRGKPWASEQLSVKGQQILETLISTE--SNDVTEIL 532 NRGKPW+ +LS +GQ+IL++L++ E S+ + EIL Sbjct: 92 PNRGKPWSHHRLSTQGQRILDSLLNPEFDSSSLDEIL 128 >ref|XP_002518652.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542033|gb|EEF43577.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 827 Score = 55.1 bits (131), Expect = 6e-06 Identities = 34/97 (35%), Positives = 52/97 (53%), Gaps = 6/97 (6%) Frame = +2 Query: 260 TTTSASPFTPLLQEILLQN----PNSTKTXXXXXXXXXXXXXXXXXXXXXXXTRLGKSGD 427 + TS+ PFTPL+Q +L+ + P+S K TR+ K+ D Sbjct: 38 SNTSSPPFTPLIQNMLINHHKIQPHSPK-------------FINPNVSIRPRTRISKARD 84 Query: 428 RNRGKPWASEQLSVKGQQILETLIST--ESNDVTEIL 532 NRGKPWAS +LS GQQ+L++LI E +++ ++L Sbjct: 85 PNRGKPWASHRLSTLGQQVLDSLIDPCFEGSELDKVL 121