BLASTX nr result
ID: Papaver23_contig00031349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031349 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531566.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 gb|EAY76467.1| hypothetical protein OsI_04402 [Oryza sativa Indi... 62 4e-08 tpg|DAA56877.1| TPA: hypothetical protein ZEAMMB73_187755 [Zea m... 62 5e-08 ref|XP_002456621.1| hypothetical protein SORBIDRAFT_03g039560 [S... 62 5e-08 ref|NP_001144248.1| uncharacterized protein LOC100277116 [Zea ma... 62 5e-08 >ref|XP_002531566.1| conserved hypothetical protein [Ricinus communis] gi|223528827|gb|EEF30832.1| conserved hypothetical protein [Ricinus communis] Length = 73 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = +2 Query: 101 KTPIRDENQIRLNLKCPPSPPKKNKTINYGAKREPPKNGYYQPPDLELLFVTPP 262 +TP E +I L CPP P KK+ T G KR+PPKNGY+QPPDL+LL PP Sbjct: 18 RTPRSRECRIPLVFVCPPPPRKKSAT---GTKRDPPKNGYFQPPDLDLLLSVPP 68 >gb|EAY76467.1| hypothetical protein OsI_04402 [Oryza sativa Indica Group] Length = 90 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +2 Query: 98 WKTPIRDENQIRLNLKCPPSPPKKNKTINYGAKREPPKNGYYQPPDLELLFVTPP 262 W+TP R+E +I L+CP +P K ++G +R PPKNGY+QPPDLE LF P Sbjct: 30 WETPKREECRIPATLRCPAAPRKA--VPDFGKRRGPPKNGYFQPPDLEALFALAP 82 >tpg|DAA56877.1| TPA: hypothetical protein ZEAMMB73_187755 [Zea mays] Length = 124 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +2 Query: 98 WKTPIRDENQIRLNLKCPPSPPKKNKTINYGAKREPPKNGYYQPPDLELLFVTPP 262 W+TP R+E +I L CP +P K ++G +R PPKNGY+QPPDLE LF P Sbjct: 65 WETPKREECRIPATLPCPAAPRKA--VPDFGKRRSPPKNGYFQPPDLEALFALAP 117 >ref|XP_002456621.1| hypothetical protein SORBIDRAFT_03g039560 [Sorghum bicolor] gi|241928596|gb|EES01741.1| hypothetical protein SORBIDRAFT_03g039560 [Sorghum bicolor] Length = 89 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +2 Query: 98 WKTPIRDENQIRLNLKCPPSPPKKNKTINYGAKREPPKNGYYQPPDLELLFVTPP 262 W+TP R+E +I L CP +P K ++G +R PPKNGY+QPPDLE LF P Sbjct: 29 WETPKREECRIPATLPCPAAPRKA--VPDFGKRRSPPKNGYFQPPDLEALFALAP 81 >ref|NP_001144248.1| uncharacterized protein LOC100277116 [Zea mays] gi|195638992|gb|ACG38964.1| hypothetical protein [Zea mays] Length = 90 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = +2 Query: 98 WKTPIRDENQIRLNLKCPPSPPKKNKTINYGAKREPPKNGYYQPPDLELLFVTPP 262 W+TP R+E +I L CP +P K ++G +R PPKNGY+QPPDLE LF P Sbjct: 31 WETPKREECRIPATLPCPAAPRKA--VPDFGKRRSPPKNGYFQPPDLEALFALAP 83