BLASTX nr result
ID: Papaver23_contig00031114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00031114 (454 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527467.1| Homeobox protein HAT3.1, putative [Ricinus c... 57 2e-06 >ref|XP_002527467.1| Homeobox protein HAT3.1, putative [Ricinus communis] gi|223533107|gb|EEF34865.1| Homeobox protein HAT3.1, putative [Ricinus communis] Length = 896 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 4/58 (6%) Frame = -2 Query: 363 SDHQGPKKIKGKKETINPELRSILE----QGDASPVSGKRNRKQFDYKKLHDETYGNV 202 S +G K+ + KK+++ EL SI E Q ++P+SGKRN ++ DYKKL+DETYGNV Sbjct: 567 STKEGSKRGRKKKQSLQSELLSIEEPNPSQDGSAPISGKRNVERLDYKKLYDETYGNV 624