BLASTX nr result
ID: Papaver23_contig00030373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00030373 (598 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_003539003.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 >ref|XP_003540667.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] Length = 711 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 279 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLA 169 DPI +FFKTR F S+DP EG+++LQKNRR +WHLA Sbjct: 96 DPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRISWHLA 132 >ref|XP_003539003.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] Length = 703 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -2 Query: 279 DPIERFFKTRAEFDSEDPHNEGRINLQKNRRSAWHLA 169 DPI +FFKTR F S+DP EG+++LQKNRR +WHLA Sbjct: 88 DPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRISWHLA 124