BLASTX nr result
ID: Papaver23_contig00027810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00027810 (489 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322104.1| auxin efflux carrier component [Populus tric... 84 9e-15 gb|AAG17172.1|AF190881_1 PIN1-like auxin transport protein [Popu... 84 9e-15 dbj|BAH47609.1| auxin:hydrogen symporter/transporter [Zinnia vio... 84 1e-14 ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier com... 84 2e-14 gb|ABQ95663.1| auxin efflux carrier, partial [Malus x domestica] 84 2e-14 >ref|XP_002322104.1| auxin efflux carrier component [Populus trichocarpa] gi|222869100|gb|EEF06231.1| auxin efflux carrier component [Populus trichocarpa] Length = 614 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +3 Query: 3 GIVPFVFAKEYNVHPQILSTGVIFGMLIALPITLVYYIILGL 128 GIVPFVFAKEYNVHP+ILSTGVIFGMLIALPITLVYYI+LGL Sbjct: 573 GIVPFVFAKEYNVHPEILSTGVIFGMLIALPITLVYYILLGL 614 >gb|AAG17172.1|AF190881_1 PIN1-like auxin transport protein [Populus tremula x Populus tremuloides] Length = 614 Score = 84.3 bits (207), Expect = 9e-15 Identities = 40/42 (95%), Positives = 42/42 (100%) Frame = +3 Query: 3 GIVPFVFAKEYNVHPQILSTGVIFGMLIALPITLVYYIILGL 128 GIVPFVFAKEYNVHP+ILSTGVIFGMLIALPITLVYYI+LGL Sbjct: 573 GIVPFVFAKEYNVHPEILSTGVIFGMLIALPITLVYYILLGL 614 >dbj|BAH47609.1| auxin:hydrogen symporter/transporter [Zinnia violacea] Length = 582 Score = 84.0 bits (206), Expect = 1e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +3 Query: 3 GIVPFVFAKEYNVHPQILSTGVIFGMLIALPITLVYYIILGL 128 GIVPFVFAKEYNVHP ILSTGVIFGMLIALPITLVYYI+LGL Sbjct: 541 GIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYIVLGL 582 >ref|XP_004144328.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] gi|449488241|ref|XP_004157978.1| PREDICTED: probable auxin efflux carrier component 1c-like [Cucumis sativus] Length = 596 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +3 Query: 3 GIVPFVFAKEYNVHPQILSTGVIFGMLIALPITLVYYIILGL 128 GIVPFVFAKEYNVHP ILSTGVIFGMLIALPITLVYYI+LGL Sbjct: 555 GIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 596 >gb|ABQ95663.1| auxin efflux carrier, partial [Malus x domestica] Length = 481 Score = 83.6 bits (205), Expect = 2e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +3 Query: 3 GIVPFVFAKEYNVHPQILSTGVIFGMLIALPITLVYYIILGL 128 GIVPFVFAKEYNVHP ILSTGVIFGMLIALPITLVYYI+LGL Sbjct: 440 GIVPFVFAKEYNVHPDILSTGVIFGMLIALPITLVYYILLGL 481