BLASTX nr result
ID: Papaver23_contig00027590
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00027590 (545 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597432.1| hypothetical protein MTR_2g097990 [Medicago ... 59 6e-07 >ref|XP_003597432.1| hypothetical protein MTR_2g097990 [Medicago truncatula] gi|355486480|gb|AES67683.1| hypothetical protein MTR_2g097990 [Medicago truncatula] Length = 289 Score = 58.5 bits (140), Expect = 6e-07 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -3 Query: 213 LWQCNKLDHAQNYLKAVPIVGLNQSIGPRQFRAVICYILGIPFFRTVEVCACCKRK-MDV 37 +++C + HAQN+L A+PI GL Q + P ++R ++ Y L IP F EVC+ C++ +D Sbjct: 63 IFECLQAAHAQNFLLAIPIDGLGQHMSPVEYRTILRYRLMIPLFPIDEVCSVCRKSCLDT 122 Query: 36 FGD 28 FG+ Sbjct: 123 FGE 125