BLASTX nr result
ID: Papaver23_contig00027563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00027563 (441 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528639.1| PREDICTED: F-box/kelch-repeat protein At3g06... 55 6e-06 ref|XP_003589019.1| Calcineurin B-like protein [Medicago truncat... 55 6e-06 ref|XP_003588958.1| F-box protein [Medicago truncatula] gi|35547... 55 6e-06 ref|XP_003623993.1| F-box protein [Medicago truncatula] gi|35549... 55 8e-06 ref|XP_002322524.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 >ref|XP_003528639.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Glycine max] Length = 375 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = -1 Query: 243 VVLDEDIVCDILSR-PVKSLLRFKCVSKRWCSLIQDPYFVDLHF 115 V L ++++ IL R PVKSLLRFKCVSK W SLI DP+F HF Sbjct: 16 VFLPQELIIQILLRLPVKSLLRFKCVSKSWLSLITDPHFAKSHF 59 >ref|XP_003589019.1| Calcineurin B-like protein [Medicago truncatula] gi|355478067|gb|AES59270.1| Calcineurin B-like protein [Medicago truncatula] Length = 293 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 249 SNVVLDEDIVCDILS-RPVKSLLRFKCVSKRWCSLIQDPYFVDLH 118 S VVL +D++ ++LS PVK LLRF+CVSK W +LI DP FV LH Sbjct: 42 SPVVLSDDLIAEVLSFLPVKYLLRFRCVSKSWKNLISDPAFVKLH 86 >ref|XP_003588958.1| F-box protein [Medicago truncatula] gi|355478006|gb|AES59209.1| F-box protein [Medicago truncatula] Length = 328 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -1 Query: 249 SNVVLDEDIVCDILS-RPVKSLLRFKCVSKRWCSLIQDPYFVDLH 118 S VL ED++ ++LS PVKSLL+F+CVSK W +LI DP FV LH Sbjct: 4 SPAVLSEDLIVEVLSFLPVKSLLQFRCVSKSWKTLISDPTFVKLH 48 >ref|XP_003623993.1| F-box protein [Medicago truncatula] gi|355499008|gb|AES80211.1| F-box protein [Medicago truncatula] Length = 445 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -1 Query: 243 VVLDEDIVCDILS-RPVKSLLRFKCVSKRWCSLIQDPYFVDLH 118 VVL +D++ ++LS PVKSL+R KCVSK W SLI DP FV LH Sbjct: 7 VVLPDDLIAELLSFLPVKSLVRLKCVSKSWKSLISDPSFVKLH 49 >ref|XP_002322524.1| predicted protein [Populus trichocarpa] gi|222867154|gb|EEF04285.1| predicted protein [Populus trichocarpa] Length = 430 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 243 VVLDEDIVCDILSR-PVKSLLRFKCVSKRWCSLIQDPYFVDLH 118 V L ED++ ILS PVKSLL F+CVS+ WCSLI+ YF+ LH Sbjct: 29 VKLPEDVIAHILSYLPVKSLLLFRCVSRLWCSLIESEYFIKLH 71