BLASTX nr result
ID: Papaver23_contig00027117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00027117 (500 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149150.1| PREDICTED: RNA polymerase-associated protein... 65 6e-09 ref|XP_003635274.1| PREDICTED: uncharacterized protein LOC100854... 63 2e-08 ref|XP_002305685.1| PAF1 complex component [Populus trichocarpa]... 63 2e-08 gb|ABA98830.1| Plus-3 domain containing protein, expressed [Oryz... 62 6e-08 ref|XP_003529309.1| PREDICTED: RNA polymerase-associated protein... 62 6e-08 >ref|XP_004149150.1| PREDICTED: RNA polymerase-associated protein RTF1 homolog [Cucumis sativus] gi|449517636|ref|XP_004165851.1| PREDICTED: RNA polymerase-associated protein RTF1 homolog [Cucumis sativus] Length = 660 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -2 Query: 499 IEATVGKRVPENDGRRHSLTLTVSDYKRRRGLL 401 IEATVG++VPENDGRRH+LTLTVSDYKRRRGLL Sbjct: 628 IEATVGRQVPENDGRRHALTLTVSDYKRRRGLL 660 >ref|XP_003635274.1| PREDICTED: uncharacterized protein LOC100854406 [Vitis vinifera] Length = 493 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 499 IEATVGKRVPENDGRRHSLTLTVSDYKRRRGLL 401 IEATVG RVPENDGRRH+LTLTV DYKRRRGLL Sbjct: 461 IEATVGCRVPENDGRRHALTLTVGDYKRRRGLL 493 >ref|XP_002305685.1| PAF1 complex component [Populus trichocarpa] gi|222848649|gb|EEE86196.1| PAF1 complex component [Populus trichocarpa] Length = 662 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 499 IEATVGKRVPENDGRRHSLTLTVSDYKRRRGLL 401 IEATVG RVPENDGRRH+LTLTV DYKRRRGLL Sbjct: 630 IEATVGCRVPENDGRRHALTLTVGDYKRRRGLL 662 >gb|ABA98830.1| Plus-3 domain containing protein, expressed [Oryza sativa Japonica Group] gi|77556035|gb|ABA98831.1| Plus-3 domain containing protein, expressed [Oryza sativa Japonica Group] gi|215697432|dbj|BAG91426.1| unnamed protein product [Oryza sativa Japonica Group] Length = 522 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 499 IEATVGKRVPENDGRRHSLTLTVSDYKRRRGLL 401 IEAT+G +VP+NDGRRH+LTLTVSDYKRRRGLL Sbjct: 490 IEATMGYKVPDNDGRRHALTLTVSDYKRRRGLL 522 >ref|XP_003529309.1| PREDICTED: RNA polymerase-associated protein RTF1 homolog [Glycine max] Length = 656 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -2 Query: 499 IEATVGKRVPENDGRRHSLTLTVSDYKRRRGLL 401 IEATVG RV ENDGRRH+LTLTVSDYKRRRGLL Sbjct: 624 IEATVGFRVSENDGRRHALTLTVSDYKRRRGLL 656