BLASTX nr result
ID: Papaver23_contig00026741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00026741 (603 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003536123.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_003556470.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 emb|CBI15328.3| unnamed protein product [Vitis vinifera] 81 2e-13 ref|XP_002514631.1| pentatricopeptide repeat-containing protein,... 81 2e-13 >ref|XP_003536123.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Glycine max] Length = 509 Score = 87.0 bits (214), Expect = 2e-15 Identities = 46/84 (54%), Positives = 55/84 (65%) Frame = -1 Query: 258 STELLKQEDGDSLPLNKRLDLHFSXXXXXXXXXXXXXXXXLSPDAGRTTVLGFHQWISSR 79 S+ELLK+ D D+L +++RL+L FS SP AGRT VLGFHQW+SS Sbjct: 71 SSELLKEPDSDALSVSQRLNLSFSHITPTPNLILQTLNL--SPQAGRT-VLGFHQWLSSN 127 Query: 78 PGFQHTDQTYSYLVDYFGRKKDFK 7 P F HTD T SY VDYFGR+KDFK Sbjct: 128 PQFSHTDDTLSYFVDYFGRRKDFK 151 >ref|XP_003556470.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like isoform 1 [Glycine max] gi|356576706|ref|XP_003556471.1| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like isoform 2 [Glycine max] Length = 509 Score = 82.4 bits (202), Expect = 6e-14 Identities = 44/84 (52%), Positives = 54/84 (64%) Frame = -1 Query: 258 STELLKQEDGDSLPLNKRLDLHFSXXXXXXXXXXXXXXXXLSPDAGRTTVLGFHQWISSR 79 S+ELLK+ D D+L +++RL L FS S ++GRT VLGFHQW+SS Sbjct: 72 SSELLKEPDSDALSVSQRLHLSFSHITPTPNLILQTLNL--SHESGRT-VLGFHQWLSSN 128 Query: 78 PGFQHTDQTYSYLVDYFGRKKDFK 7 P F HTD T SY VDYFGR+KDFK Sbjct: 129 PQFSHTDDTLSYFVDYFGRRKDFK 152 >ref|XP_002265397.2| PREDICTED: pentatricopeptide repeat-containing protein At5g60960, mitochondrial-like [Vitis vinifera] Length = 516 Score = 80.9 bits (198), Expect = 2e-13 Identities = 43/86 (50%), Positives = 55/86 (63%) Frame = -1 Query: 258 STELLKQEDGDSLPLNKRLDLHFSXXXXXXXXXXXXXXXXLSPDAGRTTVLGFHQWISSR 79 S+ELLK D + +P+ +RL L FS SPDAGRT VLGF++W+SS Sbjct: 78 SSELLKDPDSEPVPIIQRLQLSFSHITPSPPLILQTLNT--SPDAGRT-VLGFYKWLSSN 134 Query: 78 PGFQHTDQTYSYLVDYFGRKKDFKII 1 P F H+D+T S+ VDYFGR+KDFK I Sbjct: 135 PKFVHSDETISFFVDYFGRRKDFKAI 160 >emb|CBI15328.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 80.9 bits (198), Expect = 2e-13 Identities = 43/86 (50%), Positives = 55/86 (63%) Frame = -1 Query: 258 STELLKQEDGDSLPLNKRLDLHFSXXXXXXXXXXXXXXXXLSPDAGRTTVLGFHQWISSR 79 S+ELLK D + +P+ +RL L FS SPDAGRT VLGF++W+SS Sbjct: 94 SSELLKDPDSEPVPIIQRLQLSFSHITPSPPLILQTLNT--SPDAGRT-VLGFYKWLSSN 150 Query: 78 PGFQHTDQTYSYLVDYFGRKKDFKII 1 P F H+D+T S+ VDYFGR+KDFK I Sbjct: 151 PKFVHSDETISFFVDYFGRRKDFKAI 176 >ref|XP_002514631.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546235|gb|EEF47737.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 569 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/84 (48%), Positives = 54/84 (64%) Frame = -1 Query: 258 STELLKQEDGDSLPLNKRLDLHFSXXXXXXXXXXXXXXXXLSPDAGRTTVLGFHQWISSR 79 S EL+K + DSL + +RL+LHFS LSPDAGRT VLGFHQW+ Sbjct: 128 SAELIKNPNSDSLSILQRLNLHFSHINNSITPSIILQTLNLSPDAGRT-VLGFHQWLVKV 186 Query: 78 PGFQHTDQTYSYLVDYFGRKKDFK 7 F++TD+T S+ +DYFGR+KDF+ Sbjct: 187 ANFKNTDETISFFIDYFGRRKDFQ 210