BLASTX nr result
ID: Papaver23_contig00023935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00023935 (588 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544993.1| PREDICTED: uncharacterized protein LOC100805... 55 7e-06 ref|XP_003544992.1| PREDICTED: uncharacterized protein LOC100805... 55 7e-06 >ref|XP_003544993.1| PREDICTED: uncharacterized protein LOC100805286 isoform 2 [Glycine max] Length = 542 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 1 LSRISEDVYKI*VDLINQRSPEALESFVLWLLDNILTDLAAH 126 L ISED+YKI D I+ RS EAL SFVLW LD+IL+DLA+H Sbjct: 166 LLHISEDIYKISTDWISHRSYEALGSFVLWSLDSILSDLASH 207 >ref|XP_003544992.1| PREDICTED: uncharacterized protein LOC100805286 isoform 1 [Glycine max] Length = 588 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 1 LSRISEDVYKI*VDLINQRSPEALESFVLWLLDNILTDLAAH 126 L ISED+YKI D I+ RS EAL SFVLW LD+IL+DLA+H Sbjct: 212 LLHISEDIYKISTDWISHRSYEALGSFVLWSLDSILSDLASH 253