BLASTX nr result
ID: Papaver23_contig00023607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00023607 (401 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519231.1| map3k delta-1 protein kinase, putative [Rici... 58 9e-07 ref|XP_002314950.1| predicted protein [Populus trichocarpa] gi|2... 58 9e-07 ref|XP_002312329.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002519231.1| map3k delta-1 protein kinase, putative [Ricinus communis] gi|223541546|gb|EEF43095.1| map3k delta-1 protein kinase, putative [Ricinus communis] Length = 796 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 400 SDPKCRPTFQELLEILKDLQRQYSVKAQASRVAQGHST 287 SDP+CRPTFQELLE L+DLQRQY+++ QA+R A G +T Sbjct: 755 SDPQCRPTFQELLEKLRDLQRQYAIQFQAARSAAGDNT 792 >ref|XP_002314950.1| predicted protein [Populus trichocarpa] gi|222863990|gb|EEF01121.1| predicted protein [Populus trichocarpa] Length = 781 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -2 Query: 400 SDPKCRPTFQELLEILKDLQRQYSVKAQASRVAQGHST 287 SDP+CRPTFQELLE L+DLQRQY+++ QA+R A G +T Sbjct: 740 SDPQCRPTFQELLEKLRDLQRQYAIQFQAARSAAGDNT 777 >ref|XP_002312329.1| predicted protein [Populus trichocarpa] gi|222852149|gb|EEE89696.1| predicted protein [Populus trichocarpa] Length = 759 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -2 Query: 400 SDPKCRPTFQELLEILKDLQRQYSVKAQASRVAQGHSTSLAP 275 SDP+CRPTFQELLE L+DLQRQ +++ QA+R A G +T P Sbjct: 718 SDPRCRPTFQELLEKLRDLQRQCAIQVQAARSATGDNTQKEP 759