BLASTX nr result
ID: Papaver23_contig00023390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00023390 (465 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_181567.3| transducin/WD-40 repeat-containing protein [Ara... 77 1e-12 ref|XP_002881717.1| transducin family protein [Arabidopsis lyrat... 77 1e-12 gb|AAD25679.1| putative WD-40 repeat protein [Arabidopsis thaliana] 77 1e-12 gb|AER28311.1| WD40 repeat protein [Gossypium hirsutum] 77 2e-12 ref|XP_002885860.1| predicted protein [Arabidopsis lyrata subsp.... 76 2e-12 >ref|NP_181567.3| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] gi|330254724|gb|AEC09818.1| transducin/WD-40 repeat-containing protein [Arabidopsis thaliana] Length = 753 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = +3 Query: 3 VPLEILRGHSR--GVMDCTFHPRQPWLFTAGSDSVIKLYCH 119 VPLEILRGHS GV+DC FHPRQPWLFTAG+DS+IKLYCH Sbjct: 713 VPLEILRGHSSKGGVLDCKFHPRQPWLFTAGADSIIKLYCH 753 >ref|XP_002881717.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297327556|gb|EFH57976.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Length = 757 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = +3 Query: 3 VPLEILRGHSR--GVMDCTFHPRQPWLFTAGSDSVIKLYCH 119 VPLEILRGHS GV+DC FHPRQPWLFTAG+DS+IKLYCH Sbjct: 717 VPLEILRGHSSKGGVLDCKFHPRQPWLFTAGADSIIKLYCH 757 >gb|AAD25679.1| putative WD-40 repeat protein [Arabidopsis thaliana] Length = 775 Score = 77.0 bits (188), Expect = 1e-12 Identities = 34/41 (82%), Positives = 37/41 (90%), Gaps = 2/41 (4%) Frame = +3 Query: 3 VPLEILRGHSR--GVMDCTFHPRQPWLFTAGSDSVIKLYCH 119 VPLEILRGHS GV+DC FHPRQPWLFTAG+DS+IKLYCH Sbjct: 735 VPLEILRGHSSKGGVLDCKFHPRQPWLFTAGADSIIKLYCH 775 >gb|AER28311.1| WD40 repeat protein [Gossypium hirsutum] Length = 412 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/43 (81%), Positives = 37/43 (86%), Gaps = 4/43 (9%) Frame = +3 Query: 3 VPLEILRGHS----RGVMDCTFHPRQPWLFTAGSDSVIKLYCH 119 VPLEILRGH+ RGVMDC FHPRQPWLFTAG+DS IKLYCH Sbjct: 370 VPLEILRGHTSYDGRGVMDCKFHPRQPWLFTAGADSSIKLYCH 412 >ref|XP_002885860.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331700|gb|EFH62119.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 839 Score = 76.3 bits (186), Expect = 2e-12 Identities = 35/44 (79%), Positives = 37/44 (84%), Gaps = 5/44 (11%) Frame = +3 Query: 3 VPLEILRGHSR-----GVMDCTFHPRQPWLFTAGSDSVIKLYCH 119 VPLEILRGHS GV+DC FHPRQPWLFTAG+DSVIKLYCH Sbjct: 796 VPLEILRGHSTSSNGGGVLDCKFHPRQPWLFTAGADSVIKLYCH 839