BLASTX nr result
ID: Papaver23_contig00022353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00022353 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003550095.1| PREDICTED: cullin-associated NEDD8-dissociat... 72 6e-11 ref|XP_003529694.1| PREDICTED: cullin-associated NEDD8-dissociat... 72 6e-11 ref|XP_002527826.1| tip120, putative [Ricinus communis] gi|22353... 70 1e-10 ref|NP_001030954.1| cullin-associated NEDD8-dissociated protein ... 70 2e-10 ref|XP_002875136.1| cullin-associated and neddylation dissociate... 70 2e-10 >ref|XP_003550095.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Glycine max] Length = 1218 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 122 SLLSCAKPSPQSGGLAKQAFYSVAQCVDVLCLAAGDHKC 6 SLL+CAKPSPQSGG+AKQA +S+AQCV VLCLAAGD KC Sbjct: 771 SLLACAKPSPQSGGIAKQALHSIAQCVAVLCLAAGDQKC 809 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/39 (69%), Positives = 37/39 (94%) Frame = -1 Query: 448 SRLTAVRAFAVIAASPLKINI*YVLDHLISELTAFLRKA 332 +RLTAV+AFAVIAASPL++++ VL+H+++ELTAFLRKA Sbjct: 616 TRLTAVKAFAVIAASPLRVDLSCVLEHVVAELTAFLRKA 654 >ref|XP_003529694.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Glycine max] Length = 1218 Score = 71.6 bits (174), Expect = 6e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 122 SLLSCAKPSPQSGGLAKQAFYSVAQCVDVLCLAAGDHKC 6 SLL+CAKPSPQSGG+AKQA +S+AQCV VLCLAAGD KC Sbjct: 771 SLLACAKPSPQSGGIAKQALHSIAQCVAVLCLAAGDQKC 809 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/39 (69%), Positives = 37/39 (94%) Frame = -1 Query: 448 SRLTAVRAFAVIAASPLKINI*YVLDHLISELTAFLRKA 332 +RLTAV+AFAVIAASPL++++ VL+H+++ELTAFLRKA Sbjct: 616 TRLTAVKAFAVIAASPLRVDLSCVLEHVVAELTAFLRKA 654 >ref|XP_002527826.1| tip120, putative [Ricinus communis] gi|223532750|gb|EEF34529.1| tip120, putative [Ricinus communis] Length = 1218 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 122 SLLSCAKPSPQSGGLAKQAFYSVAQCVDVLCLAAGDHKC 6 SLLS AKPSPQSGG+AKQA YS+AQCV VLCLAAGD KC Sbjct: 771 SLLSSAKPSPQSGGVAKQALYSIAQCVAVLCLAAGDQKC 809 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/39 (71%), Positives = 37/39 (94%) Frame = -1 Query: 448 SRLTAVRAFAVIAASPLKINI*YVLDHLISELTAFLRKA 332 +RLTAV+AFAVIA+SPL+I++ VL+H+I+ELTAFLRKA Sbjct: 616 TRLTAVKAFAVIASSPLRIDLSCVLEHVIAELTAFLRKA 654 >ref|NP_001030954.1| cullin-associated NEDD8-dissociated protein 1 [Arabidopsis thaliana] gi|3184283|gb|AAC18930.1| unknown protein [Arabidopsis thaliana] gi|330250502|gb|AEC05596.1| cullin-associated NEDD8-dissociated protein 1 [Arabidopsis thaliana] Length = 1217 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 122 SLLSCAKPSPQSGGLAKQAFYSVAQCVDVLCLAAGDHKC 6 SLLSCAKPSPQSGG+ KQA YS+AQCV VLCLAAGD C Sbjct: 770 SLLSCAKPSPQSGGVPKQALYSIAQCVAVLCLAAGDKNC 808 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 448 SRLTAVRAFAVIAASPLKINI*YVLDHLISELTAFLRKA 332 +RLTAV+AF+VIA SPL IN+ VLDHLI+ELT FLRKA Sbjct: 615 TRLTAVKAFSVIATSPLHINLSCVLDHLIAELTGFLRKA 653 >ref|XP_002875136.1| cullin-associated and neddylation dissociated, hemivenata [Arabidopsis lyrata subsp. lyrata] gi|297320974|gb|EFH51395.1| cullin-associated and neddylation dissociated, hemivenata [Arabidopsis lyrata subsp. lyrata] Length = 1219 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -3 Query: 122 SLLSCAKPSPQSGGLAKQAFYSVAQCVDVLCLAAGDHKC 6 SLLSCAKPSPQSGG+ KQA YS+AQCV VLCLAAGD C Sbjct: 772 SLLSCAKPSPQSGGVPKQALYSIAQCVAVLCLAAGDKNC 810 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 448 SRLTAVRAFAVIAASPLKINI*YVLDHLISELTAFLRKA 332 +RLTAV+AFAVIA SPL I++ VLDHLI+ELT FLRKA Sbjct: 617 TRLTAVKAFAVIATSPLHIDLSCVLDHLIAELTGFLRKA 655