BLASTX nr result
ID: Papaver23_contig00022078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver23_contig00022078 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, puta... 73 3e-11 ref|XP_002277029.1| PREDICTED: 26S proteasome non-ATPase regulat... 71 1e-10 ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulat... 70 2e-10 ref|XP_004144521.1| PREDICTED: 26S proteasome non-ATPase regulat... 70 2e-10 ref|XP_002327906.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 >ref|XP_002517858.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] gi|223542840|gb|EEF44376.1| 26S proteasome regulatory subunit rpn1, putative [Ricinus communis] Length = 895 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 410 AGASVDSARHNLAATFLNTFVNAGFGQDKLMTVPSDA*SGGTT 282 AG SVDSAR NLAATF+N FVNAGFGQDKLMTVPSD+ SGG++ Sbjct: 361 AGVSVDSARQNLAATFVNAFVNAGFGQDKLMTVPSDSSSGGSS 403 >ref|XP_002277029.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A [Vitis vinifera] gi|302143338|emb|CBI21899.3| unnamed protein product [Vitis vinifera] Length = 890 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 410 AGASVDSARHNLAATFLNTFVNAGFGQDKLMTVPSDA*SGGTT 282 AGASVDSAR NLAATF+N FVNAGFGQDKLMTV S+A SGG++ Sbjct: 356 AGASVDSARQNLAATFVNAFVNAGFGQDKLMTVASEASSGGSS 398 >ref|XP_003527419.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Glycine max] Length = 885 Score = 70.1 bits (170), Expect = 2e-10 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -1 Query: 410 AGASVDSARHNLAATFLNTFVNAGFGQDKLMTVPSDA*SGGTTSG 276 AGASVDSAR NLAATF+N FVNAGFGQDKLMTVPSD+ S +SG Sbjct: 352 AGASVDSARQNLAATFVNAFVNAGFGQDKLMTVPSDS-SSSASSG 395 >ref|XP_004144521.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Cucumis sativus] gi|449522658|ref|XP_004168343.1| PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 1A-like [Cucumis sativus] Length = 896 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 410 AGASVDSARHNLAATFLNTFVNAGFGQDKLMTVPSDA*SGGTT 282 AGASVDSAR NLAATF+N FVNAGFGQDKLMTV DA SG +T Sbjct: 362 AGASVDSARQNLAATFVNAFVNAGFGQDKLMTVTPDASSGAST 404 >ref|XP_002327906.1| predicted protein [Populus trichocarpa] gi|222837315|gb|EEE75694.1| predicted protein [Populus trichocarpa] Length = 890 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -1 Query: 410 AGASVDSARHNLAATFLNTFVNAGFGQDKLMTVPSDA*SGGT 285 AGASVDSAR NLAATF+N F+NAGFGQDKLMT P+D+ SGG+ Sbjct: 357 AGASVDSARQNLAATFVNAFLNAGFGQDKLMTPPTDSSSGGS 398